KEGG   Streptomyces sp. SirexAA-E: SACTE_2613Help
Entry
SACTE_2613        CDS       T01601                                 

Definition
(GenBank) dimethyladenosine transferase
  KO
K02528  
16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
Enzymes [BR:ssx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.182  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase
     SACTE_2613
Ribosome biogenesis [BR:ssx03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    SACTE_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2949052..2950032)
Genome map
AA seq 326 aa AA seqDB search
MSTTEPDALLGPADIRELAAALGVRPTKQRGQNFVIDANTVRRIVRTAEVRPEDVVVEIG
PGLGSLTLALLEAADRVVAVEIDDVLAGALPATVAARLPVRADRFALVHSDAMLVTELPG
PAPTALVANLPYNVAVPVLLTMLERFPSIERTLVMVQAEVADRLAAKPGNKVYGVPSVKA
AWYADVKRAGSIGRTVFWPAPNVDSGLVSLVRRTEPIRTTASRTEVFAVVDAAFAQRRKT
LRAALAGWAGSAAAAETALVAAGVSPQARGEALTVEEFAAIAENKPEVNKPEADKPEVSR
PEVDKPEVDKPEDDKTAGNETSGSEA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccacagagcccgacgccctcctgggccccgcagacattcgcgagctggccgca
gcgctgggcgtacgccccaccaagcagcgcggacagaacttcgtcatcgacgccaacacg
gtccgccgcatcgtccggaccgcggaggtgcgccccgaggacgtggtggtcgagatcggt
cccggtctgggctcgctgacgctggcgctcctggaggcggccgaccgggtcgtcgccgtg
gagatcgacgacgtactcgcgggcgccctgccggccaccgtcgccgcccggctcccggta
cgcgccgaccgcttcgccctggtgcactccgacgcgatgctggtcaccgagcttcccggc
ccggcgccgaccgcgctggtcgccaacctcccgtacaacgtggccgtgccggtgctgctc
accatgctggagcgcttcccgtccatcgagcggacgctcgtgatggtgcaggccgaggtc
gccgaccggctggccgccaagcccggcaacaaggtctacggcgtgccctccgtgaaggcc
gcctggtacgccgacgtcaagcgtgccgggtcgatcgggcgcacggtgttctggcccgcg
ccgaacgtcgactccgggctggtgtccctggtgcggcgcaccgagccgatccggaccacg
gcgagccgcaccgaggtcttcgccgtcgtcgacgccgcgttcgcccagcgccgcaagacg
ctgcgcgccgcgctggccggctgggcgggctccgccgcggccgccgagaccgccctcgtc
gcggcgggcgtctccccgcaggcgcggggcgaggcactgacggtcgaggagttcgccgcc
atcgcggagaacaagcccgaggtgaacaagccggaggccgacaagcccgaggtgagcagg
cccgaggtggacaagcccgaggtggacaagcccgaggacgacaagaccgcggggaacgag
acgtccgggagcgaagcatga

DBGET integrated database retrieval system