KEGG   Streptomyces sp. SirexAA-E: SACTE_2616Help
Entry
SACTE_2616        CDS       T01601                                 

Definition
(GenBank) Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
  KO
K07056  
16S rRNA (cytidine1402-2'-O)-methyltransferase [EC:2.1.1.198]
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
Enzymes [BR:ssx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.198  16S rRNA (cytidine1402-2'-O)-methyltransferase
     SACTE_2616
Ribosome biogenesis [BR:ssx03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    SACTE_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2951599..2952486)
Genome map
AA seq 295 aa AA seqDB search
MTGTTGTLVLAGTPIGDVADAPPRLAVELETADVVAAEDTRRLRRLTQALGIHTTGRVVS
YFEGNESARTPELVEALVGGARVLLVTDAGMPSVSDPGYRLVAAAVEQGIKVTAVPGPSA
VLTALALSALPVDRFCFEGFLPRKTGERLGKLREVADERRTMVFFEAPHRLDDTLAAMAE
VFGADRRAAVCRELTKTYEEVKRGPLGELAVWAAEGVRGEITVVVEGATDTGGEKPDAAE
LVRRVQVREEAGERRKEAIAAVATEAHLPKREVFDAVVAAKNAARTGPAEGKGPA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgactggaacgactggaacgctcgtactcgcagggacccccatcggcgacgtggcggac
gccccgccgaggctcgccgtcgaactggagaccgccgacgtggtcgccgccgaggacacc
cgccggctgcgccggctcacccaggccctgggcatccacacgacggggcgcgtcgtctcc
tacttcgagggcaacgagtccgcgcggacgcccgagctggtcgaggcgctcgtcggcggg
gcccgggtcctgctcgtcacggacgcggggatgccgtcggtctccgacccgggctaccgg
ctcgtcgcggcggccgtcgaacagggcatcaaggtcaccgccgtgccgggaccgtccgcc
gtgctgaccgcgctggccctgtccgccctgcccgtggaccgcttctgcttcgagggcttc
ctgccgcgcaagacgggcgagcggctcgggaagctgcgtgaggtcgccgacgaacggcgc
accatggtcttcttcgaggcaccgcaccggctggacgacaccctggcggcgatggccgag
gtgttcggcgcggaccgccgggccgccgtgtgccgggagctgaccaagacgtacgaggag
gtcaagcgcggcccgctgggcgagctggccgtctgggccgccgaaggggtgcggggcgag
atcaccgtcgtcgtcgagggcgccacggacaccggcggcgagaagccggacgccgccgag
ctggtgcgcagggtgcaggtgcgcgaggaggcgggggagcggcgcaaggaggccatcgcg
gcggtcgccaccgaggcccacctgcccaaacgcgaggtcttcgatgcggtggtcgcggca
aagaacgcggccaggaccggcccggccgaaggcaaaggaccggcctga

DBGET integrated database retrieval system