KEGG   Streptomyces sp. SirexAA-E: SACTE_2619Help
Entry
SACTE_2619        CDS       T01601                                 

Definition
(GenBank) YbaK/prolyl-tRNA synthetase associated region
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2956669..2957163
Genome map
AA seq 164 aa AA seqDB search
MTPTTTSSDAHPRFAEALRELGLDVGVRRFPDATRTAAEAAAAIGCELSQIVKSLIFEAD
GAPVLVLMDGSSRVDVERVRAELGAGKVKRAGADLVREATGYAIGGVPPFGHRTKSRVLA
DRGLLDHAVVWAAAGTPHTVFPLDPKSLIAHAGGTLVDVREQIA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacccccaccacgacctcatccgacgcccacccccggttcgccgaggccctgcgtgag
ctgggcctcgacgtcggcgtacgccgcttcccggacgccacccgcaccgccgccgaggcc
gccgccgcgatcggctgcgagctcagccagatcgtcaagtcgctgatcttcgaggcggac
ggcgcaccggtgctcgtcctgatggacggctcctcccgggtggacgtcgagcgcgtacgg
gccgagctcggcgcgggcaaggtcaaacgggccggggccgacctggtgcgggaggccacg
gggtacgccatcggcggcgtcccgcccttcggccaccgtacgaagtcccgggtgctggcc
gaccgcggcctgctcgaccacgcggtggtgtgggcggccgcgggcaccccgcacacggtc
ttcccgctcgacccgaagagtctgatcgcgcatgccggcggcaccctggtggacgtgcgc
gagcagatcgcgtga

DBGET integrated database retrieval system