KEGG   Streptomyces sp. SirexAA-E: SACTE_2620Help
Entry
SACTE_2620        CDS       T01601                                 

Definition
(GenBank) protein of unknown function DUF6 transmembrane
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2957160..2958011
Genome map
AA seq 283 aa AA seqDB search
MTPLVAAAVLVAAMTHAGWNAIAHAIRDQLLSFTLISGGGALIGAVLAVAAPLPAAGAWP
YLLLSSALHVAYMALLMRSFTLGDFGQMYPIARGTAPLVVTVLAAVFVGERPDGWATAGV
AVASAGLVGLALWGIRGSGKRPNGPAILAALATGLAIAGYTTVDGVGVRASGTPLGYIAW
LMIVQGVVIPAYAFWRRRGALAAQVSPYLRRGLIGAALSVTAYALVLWAQTKAPLAPVAA
LRESSIIVGAAIGALFFKERFGAPRIAAAGLMVVGIGLMLHTS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgctggtggcggccgccgtcctggtggccgcgatgacccacgccggctggaac
gccatcgcccacgcgatacgcgaccagctcctgtccttcaccctgatctccgggggcggg
gcgctgatcggcgccgtcctggccgtggccgcaccgctcccggcggccggagcctggccg
tacctgctgctctcctcggcgctgcacgtggcctacatggcgctgctgatgcgctcgttc
actctgggcgacttcggccagatgtatccgatcgcccggggcacggccccgctcgtggtg
acggtcctggccgccgtcttcgtcggtgagcgccccgacggctgggcgaccgcgggggtg
gcggtggcctctgccgggcttgtggggctcgcgttgtggggcatccgggggtccggcaag
cgcccgaacggcccggcgatcctggccgccctggcgaccggcctggccatcgccgggtac
accacggtcgacggggtcggggtgcgcgcctcgggcaccccgctcggctacatcgcctgg
ctgatgatcgtccagggcgtcgtcatccccgcctacgccttctggcgccgacgcggcgcg
ctggccgcccaggtgtccccgtacctgaggcgcggactcatcggggcggccctgtcggtc
accgcgtacgccctcgtgctgtgggcccagaccaaggccccgctggccccggtcgcggcc
ctgcgggagtcctcgatcatcgtgggcgccgcgatcggggcgctgttcttcaaggaacgg
ttcggcgcgccgcgaatcgcggcggccgggctgatggtcgtgggcatcgggctgatgctg
cacacgagttga

DBGET integrated database retrieval system