KEGG   Streptomyces sp. SirexAA-E: SACTE_2621Help
Entry
SACTE_2621        CDS       T01601                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2958128..2958922)
Genome map
AA seq 264 aa AA seqDB search
MTDIISTRLAGCTALVTGAGRGIGAATARRLAAEGAAVLVTDLVADRASHTAGEIRERGG
TAEALACDVGDRAAVEAAVAHAVAVFGGLDILVNNAYANHEDAELFEDEADDSWDHTLDI
TLSGPYRCSRAALPHLVASGRGAVVNIGSVNGEQDFGGHAYSAAKAGLGSLTRTLAGHAG
PRGVRVNLVAPGTIRTEGWAGRDDDLARASALYPLGRIGEPDDIAAAVAFLASSDASWVT
GTTLRVDGGLMGVNTGFRKAMRGE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcatcagcacacgtctggccggatgcaccgcactcgtcaccggagcgggc
cggggcatcggcgccgccacggcccgccgcctggccgccgagggcgcggccgtcctcgtc
accgacctggtcgccgaccgggcctcgcacaccgccggggagatacgggagaggggcggc
accgccgaagccctggcctgcgacgtgggcgaccgcgccgccgtcgaggcggcggtggcc
cacgccgtcgccgtcttcggcgggctcgacatcctcgtcaacaacgcctacgccaaccac
gaggacgccgagctcttcgaggacgaggcggacgactcctgggaccacacgctcgacatc
accctgtccggcccctaccgctgctcccgggccgcgctgccgcacctggtggcctcgggc
cggggcgccgtcgtcaacatcggttccgtcaacggcgagcaggacttcggcgggcacgcc
tacagcgccgcgaaggcgggcctgggcagcctcacccggacactggccggccacgcgggc
ccgcgcggggtcagggtcaacctggtcgcccccggcaccatccgcaccgaggggtgggcc
gggcgcgacgacgacctggcgcgggcgagcgccctctacccgctcggccggatcggtgaa
ccggacgacatcgcggccgccgtggccttcctggcgtcctcggacgcgtcctgggtcacc
gggacgaccctgcgggtggacggcggcctgatgggcgtcaacaccggcttccgcaaggcg
atgcggggcgagtag

DBGET integrated database retrieval system