KEGG   Streptomyces sp. SirexAA-E: SACTE_2625Help
Entry
SACTE_2625        CDS       T01601                                 

Definition
(GenBank) cobalamin (vitamin B12) biosynthesis CbiM protein
  KO
K02007  
cobalt/nickel transport system permease protein
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SACTE_2625
Transporters [BR:ssx02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalt transporter [MD:M00245] [OT]
    SACTE_2625
   Nickel transporter [MD:M00246] [OT]
    SACTE_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2961696..2962754)
Genome map
AA seq 352 aa AA seqDB search
MHVPDGFINAPVSAVAGVVAAGAVAVSLRGARRELGGERAAPLAGLVAAFIFAVQMLNFP
VAAGTSGHLLGGALAAILVGPFTGVLCIAVVLLMQGILFADGGLTALGVNITVMGVVTVV
VAYALFRGLTGVLPRTRRSTTAAAFVAALVSVPAAAVAFTAIYAIGGTTDVPIGKVLTAM
VGVHVLIGIGEAVITALTVGAVLAVRPDLVHGARGLAAPLKLRVDGELVDAPAAAPAPAA
ARAHSTRKVWATGLVAALLLAGFVSYYASANPDGLEKVAADKGIDEKVEEHGAADSPLAD
YGVKSITDPRISGGLAGVIGVGVTVVVGSGVFWAVHRRRTRQEPATTSHGSV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtacccgacggattcatcaacgcacctgtgtccgccgtggccggcgtggtcgcc
gccggggcggtcgcggtcagcctccggggggcgcggcgggagctcggaggagagcgggcc
gcgcccctcgccgggctcgtcgcggccttcatcttcgccgtgcagatgctgaacttcccg
gtcgccgctggcaccagcggccacctcctgggcggggcgctcgcggcgatcctggtcggg
cccttcaccggggtgctctgcatagcggtcgtcctgctgatgcagggcatcctcttcgcc
gacggcggcctcaccgcgctcggcgtcaacatcaccgtcatgggcgtcgtcaccgtcgtc
gtcgcgtacgccctcttccgcgggctcaccggcgtcctgccccgcacccggcgctcgacg
accgcggcggccttcgtggccgcgctggtctccgtaccggccgccgccgtcgccttcacc
gccatctacgcgatcggcgggaccaccgacgtacccatcggcaaggtcctcaccgcgatg
gtcggtgtgcacgtcctcatcggcatcggcgaggccgtcatcaccgcactgaccgtcggc
gcggtcctcgcggtgcgcccggacctcgtccacggggcccgcgggctcgccgccccgctg
aagctgcgcgtcgacggcgagctcgtcgacgccccggccgccgcgcccgcccccgccgcc
gcccgcgcccactccacccgcaaggtctgggcgaccggcctggtggcggccctcctgctc
gccgggttcgtctcgtactacgcctccgcgaaccccgacggcctggagaaggtcgccgcc
gacaagggcatcgacgagaaggtcgaggagcacggcgccgccgactccccgctcgccgac
tacggcgtcaagagcatcaccgacccccggatctccggcggcctcgccggggtgatcggg
gtcggcgtcaccgtcgtcgtcggcagcggtgtcttctgggccgtgcaccggcgccgcacc
cggcaggaacccgccaccacctcccacgggtccgtctga

DBGET integrated database retrieval system