KEGG   Streptomyces sp. SirexAA-E: SACTE_2629Help
Entry
SACTE_2629        CDS       T01601                                 

Definition
(GenBank) peptidase S41
  KO
K08676  
tricorn protease [EC:3.4.21.-]
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SACTE_2629
Peptidases [BR:ssx01002]
 Serine Peptidases
  Family S41: C-terminal processing peptidase family
   SACTE_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2966560..2969964
Genome map
AA seq 1134 aa AA seqDB search
MSDDVAYLRFPHLHEDLLCFAAEDDLWVAPLAPAGQRPGRAWRVTVDRTRVSHPRFSPDG
SRIAYTTWRTLDPEIHLAPVDGGPARRLTYWGSTDARVCGWSPDPGDSSQILAVSSHNQP
FSYFSWAYSVPTDGSPGGKLPWGPVSDIAVADIDGERRTLLLTGKPPHEPAAWKRYRGGA
MGRLWLHGERLLPDIGGHLDAPMFVGGRIAFLSDHEGVGNLYSCRPDGGDLRRHTDHDAF
YARHASSDGNRVVYQCAGDLWLVDDLEDPDAVPRKLEVRLGGPRTGRRTYQVPASSHVDA
LSVDETGRASAVSVRGSLYWLTHRDGPARTIADEPGVRVRLPEMLGSSGQVAYITDADGA
DAVEIAYLPRASGDRPPRRLASGQLGRVHEMVADPEGTRLALASNDGRLLLLDTAGDETE
QEVAALDGVALLDSADAQAALLDAIEEQGSAPPPPPPAEAQVTELIRSVNGPVRDLAFSP
DGAWLTWSHPGIGRSLRKIKLARISGPDAPVIVDVTNGRFEDENPVFTGDGRYLAFLSWR
GFDPVYDVHTGDLSFPLGCRPYLVPLSSATPSPFALLPDGRPAAGGLDPVDIPDGAVEGT
TVTVEFEGLENRVTPFPVSASKYSALQPVSGGGLVWLRWPISGALGETFANPADMSGRPT
LEHFSIARARRTQLVAHLDGFAVSGDRSRLVVMDDGELRAVPSDEPGDNDTTVYLDLRRI
LHDVDPAAEWRQAYDEAGRIIRAYFWEPDMCGIDWDAVLDQYRPLVERVASPDEFADLLR
ELLGELGTSHAYVSPARRNEGPPHYQRAIGLLGANLACRDGDWTVLRILPGDSSDSKARS
PLAGAGIREGAVLTHVDGRRVDPVAGPYPLLTAAGGTTVELTFRPAGGEGGGRPRRVAVV
PLIDERPLRYQDWVAKRREVVRELSGGRCGYLHIPDMGGSGWAQFNRDLRLEVSRPALIV
DVRGNAGGHISELVVEKLTRAILGWDLTRNAQPVSYASNAPRGPVVALADEATSSDGDMI
TAAFRLLKLGPVVGQRTWGGVVGMTGRHRLGDGTVITVPMNAAWFDTYGWSVENHGVEPD
LEALRTPLDWAEGRHAVLDDAVKVALDLLASHPASTPPTYATVPDLRRPPLPPR
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacgacgtcgcgtatctccgcttcccgcacctccacgaggacttgctctgcttc
gcggccgaggacgacctctgggtcgcccccctcgcccccgcggggcagcggcccggccgc
gcgtggcgggtgaccgtcgaccgcacccgggtgagccacccgcgcttctcgccggacggc
agccgtatcgcctacacgacctggcgcacgctcgacccggagatccacctggcccccgtc
gacgggggccccgcccgcagactcacgtactggggctcgaccgacgcccgggtctgcggc
tggagccccgaccccggcgacagctcccagatcctcgccgtgtcctcgcacaaccagccg
ttctcgtacttctcgtgggcctacagcgtccccaccgacggcagccccggcggcaagctg
ccctgggggccggtctccgacatcgcggtcgccgacatcgacggcgagcgccgcaccctg
ctgctcaccggcaagccgccgcacgagcccgccgcgtggaagcgctaccggggcggggcc
atgggacggctgtggctgcacggcgagcggctgctgccggacatcggcggccacctcgac
gccccgatgttcgtcgggggccgcatcgccttcctctccgaccacgagggcgtcggcaac
ctctactcgtgccggccggacggcggcgacctgcgccgccacaccgaccacgacgccttc
tacgcccggcacgcgtccagcgacggcaaccgggtcgtctaccagtgcgcgggcgacctg
tggctggtcgacgacctggaggacccggacgccgtcccgcgcaagctggaggtacgcctc
ggcggccccaggaccgggcgccgcacctaccaggtgcccgcgtcgagccacgtcgacgcc
ctgtccgtggacgagacgggccgggccagcgccgtctccgtacgcggcagcctgtactgg
ctcacgcaccgcgacgggcccgcccgcaccatcgccgacgagcccggggtgcgcgtccgg
ctgcccgagatgctgggcagcagcggccaggtcgcctacatcaccgacgcggacggcgcg
gacgccgtcgagatcgcctacctgccccgtgccagcggcgaccggccgccacgcaggctg
gcctccgggcagctgggccgcgtccacgagatggtcgcggacccggaggggacccgtctc
gccctcgcctcgaacgacggccgcctgctgctgctggacacggccggcgacgagacggaa
caggaggtggccgccctggacggggtcgccctcctggacagcgccgacgcgcaggccgcc
ctgctggacgccatcgaggagcagggctccgccccgcctcccccgccgcctgccgaggcc
caggtgaccgagctcatccgctccgtcaacggcccggtccgcgacctggcgttctccccg
gacggcgcctggctgacctggtcgcacccgggcatcggccggtcgctgcggaagatcaag
ctggcccggatcagcggacccgacgccccggtgatcgtcgacgtcaccaacggccgcttc
gaggacgagaacccggtcttcaccggtgacggccgctacctcgccttcctctcctggcgc
ggcttcgacccggtgtacgacgtccacaccggcgacctctccttcccgctgggctgccgc
ccctacctcgtgccgctctcctcggcgacgccctcccccttcgccctgctcccggacggc
cggcccgcggccggcggactggacccggtggacatccccgacggcgccgtcgaagggacc
acggtcaccgtggagttcgaggggctggagaacagggtgacgcccttcccggtatccgcg
tcgaagtactcggcgctccagccggtcagcgggggcgggctggtctggctgcgctggccc
atctccggcgcgctgggcgagacgttcgccaaccccgcggacatgtcgggccgccccacc
ctggagcacttcagcatcgccagggcgcgccggacccaactggtcgcccacctcgacggc
ttcgcggtcagcggcgaccgctcccggctggtcgtcatggacgacggcgaactgcgcgcc
gtcccgtccgacgagcccggcgacaacgacaccaccgtctacctcgacctgcgccgcatc
ctgcacgacgtcgacccggccgcggaatggcggcaggcctacgacgaggcgggccgcatc
atccgggcctacttctgggagccggacatgtgcggcatcgactgggacgccgtcctggac
cagtaccggccgctggtcgaacgggtcgcctcccccgacgagttcgcggacctgctgcgc
gaactcctgggcgagctgggcacctcccacgcctacgtgtcccccgcccgccgcaacgag
ggcccgccgcactaccagcgggcgatcggtctgctcggcgccaacctggcgtgccgggac
ggcgactggacggtcctgcggatcctgcccggcgactcctcggactccaaggcgcgctcc
ccgctcgccggtgcggggatccgcgagggcgccgtcctcacccatgtcgacggccgccgg
gtggacccggtggcgggaccctatccgctgctcacggcggcgggcgggacgacggtcgag
ctgaccttccgtccggcgggcggcgagggcggcggccggccccgccgtgtcgcggtcgtc
ccgctgatcgacgaacgccccctgcgctaccaggactgggtcgccaagcgccgcgaggtc
gtccgcgaactgagcggcggcaggtgcgggtacctgcacatcccggacatgggcggctcg
ggctgggcgcagttcaaccgcgacctgcgcctggaggtgtcacgcccggccctgatcgtg
gacgtgcgcggcaacgcgggcggacacatcagcgagctggtcgtcgagaagctcacccgc
gcgatcctcggctgggacctcacccgcaacgcccagccggtctcgtacgcgtccaacgcc
ccccggggcccggtggtggccctcgccgacgaggcgacctcctccgacggcgacatgatc
acggcggccttccggctgctgaagctggggccggtcgtgggccagcgcacctggggcggg
gtggtcggcatgaccggacgccaccggctcggcgacggcacggtgatcacggtgccgatg
aacgcggcctggttcgacacgtacggctggtccgtcgagaaccacggcgtcgaaccggac
ctggaggccctgcgcacccccctggactgggcggagggccgtcacgcggtcctggacgac
gcggtcaaggtggccctggacctcctggcgtcccacccggcctccacaccgccgacgtac
gccacggtgccggacctgcgacggcccccgctgcccccgcgctga

DBGET integrated database retrieval system