KEGG   Streptomyces sp. SirexAA-E: SACTE_2631Help
Entry
SACTE_2631        CDS       T01601                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2970327..2971211)
Genome map
AA seq 294 aa AA seqDB search
MSGRRSLEGQVVVVTGAARGVGELLARKLSARGAKLALVGLEPDELKKVSERLHSDSDHW
FADVTDHEAMAQVAREVKERFGKIDVVVANAGVATGGPLVDSDPVAWRRVIEVNLIGGAV
TARAFLPVVMESRGYFLQIASLAALTPAPMMSAYCASKSGVEAFAHSLRAEVGYRGVKVG
VGYLSWTDTDMVRGADEDDVMRELRQRLPWPTNRTYPLGPAVDRIVAGIERRSAHVYGQW
WLRGMQSVRGALPTVIGIVGQREMQRFGTRLDGVTKGLVGAGGAADQDARAQRH
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaggcggagtctcgaaggacaggtcgtcgtcgtcaccggagcggcacgcggg
gtgggtgaactgctcgcccgcaagttgtcggcacgtggcgcgaagctggccctcgtcggt
ctggagccggacgagctgaagaaggtctccgagcggctgcactcggacagcgaccactgg
ttcgcggacgtcaccgaccacgaggcgatggcccaggtcgcccgtgaggtcaaggaacgc
ttcggcaagatcgacgtcgtggtcgccaacgccggggtcgccacgggcgggccgctcgtg
gactccgaccccgtcgcctggcgccgggtcatcgaggtgaacctgatcggcggcgccgtc
acggcgcgggcgttcctgccggtcgtcatggagagccgcggctacttcctccagatagcg
tcgctggccgcgctcaccccggcgccgatgatgagcgcgtactgcgcctccaagtcgggt
gtggaggcgttcgcgcacagtctgcgcgcggaggtcggctaccggggcgtgaaggtcggg
gtcggctacctgtcctggaccgacacggacatggtgcgcggtgccgacgaggacgacgtc
atgcgggagttgcggcagcggctgccctggccgaccaaccgcacctacccgctgggcccg
gccgtggaccggatcgtggcgggcatcgagcggcgctcggcccatgtgtacggccagtgg
tggctgcgggggatgcagtcggtccggggagcgctgccgaccgtgatcgggatcgtcgga
cagcgtgagatgcagcggttcgggacgcggctggacggcgtcaccaagggactcgtgggg
gccggcggcgcggcggaccaggacgcgcgagcgcagcgtcactga

DBGET integrated database retrieval system