KEGG   Streptomyces sp. SirexAA-E: SACTE_2633Help
Entry
SACTE_2633        CDS       T01601                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein domain protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMO-like Pyr_redox_3 Pyr_redox_2 NAD_binding_8 K_oxygenase NAD_binding_9 DAO FAD_binding_2 FAD_oxidored FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AEN10519
UniProt: G2NHT3
Position
complement(2972146..2973669)
Genome map
AA seq 507 aa AA seqDB search
MAQHEHVRVAVIGSGFGGLGAAVRLRREGITDFLVLERAGSVGGTWRDNSYPGCACDVPS
HLYSFSFAPNPDWPRTFSGQEHIRAYLERVADTFGLRPHIRLNHEVTLMRWDNDALHWVI
EAANGATFTADVVVSATGPLSDPKLPDIPGLADFPGKVFHSAQWDHDYDLAGKRVAVIGT
GASAIQIVPEIQPQARRLTLFQRTPPWVMPRMDRAISGAEKWLHRALPFTGTARRGLLWG
IRELQVGAFTKHPDQLGLVERIAKANMARAIKDPQLRAKLTPSYRIGCKRILLSNAYYPA
LAEPNVDVVASGLSEVRGSTLVASDGTETEADVIVLGTGFHVTDMPIADRVVGAEGITLA
ESWKDGMESLRGASAAGFPNWMTIIGPNTGLGNSSMILMIESQLNYMADYLRQLDVLGGR
VALGARSSAVGAWNRRVQDRMKRTVWNTGGCTSWYLDSTGRNTTVWPGTTAEFRRATRAV
DLAEYEVIRPPVPNGPRKAVLAEEAAR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcacgagcacgtacgagtggcggtgatcggatccggattcgggggcctcggg
gccgcggtccggctccgccgcgaaggcatcaccgacttcctggtcctggagcgagccggt
tccgtcggtggtacctggcgcgacaacagctacccgggctgcgcctgcgacgtaccgtcc
cacctctactccttctcgttcgcgcccaaccccgactggccgcgcaccttctccgggcag
gagcacatccgcgcctacctggagcgtgtggccgacaccttcgggctgcgcccgcacatc
cggctgaaccacgaagtcaccctgatgcgctgggacaacgacgcgctgcactgggtgatc
gaggcggcgaacggtgccaccttcaccgcggacgtcgtcgtctccgcgaccggtccgctc
tccgaccccaagctgcccgacataccggggctcgccgacttcccgggcaaggtcttccac
tccgcgcagtgggaccacgactacgacctcgcgggcaagcgcgtcgcggtgatcggcacc
ggcgcctccgccatccagatcgtgccggagatccagccgcaggcccgccggctcaccctc
ttccagcggaccccgccctgggtgatgccgcgcatggaccgcgcgatcagcggcgccgag
aagtggctgcaccgcgcgctccccttcaccggcaccgcgcgccgcggactgctctggggc
atccgggagttgcaggtgggtgccttcaccaagcaccccgaccagctcggcctcgtggag
cggatagccaaggccaacatggcacgggcgatcaaggatccgcagctgcgggccaagctg
accccctcctaccgcatcggctgcaagcgcatcctgctctccaacgcctactaccccgcg
ctcgccgagcccaatgtggacgtggtcgcctccggtctgtccgaggtgcgcggctccacc
ctcgtcgcctcggacggtacggagaccgaggcggacgtcatcgtcctcggcaccggcttc
cacgtgacggacatgccgatcgcggaccgggtcgtcggcgccgagggcatcacgctcgcc
gagtcctggaaggacggcatggagtcgctgcgcggcgcgagcgccgcgggcttccccaac
tggatgacgatcatcggccccaacaccgggctcgggaactcctcgatgatcctgatgatc
gagtcccagctgaactacatggccgactacctgcgccaactggacgtgctcggcggccgt
gtcgccctgggtgcccgctcctccgccgtcggcgcctggaaccggcgggtccaggaccgg
atgaagcggaccgtgtggaacaccgggggctgcaccagctggtacctggactccaccggc
cgcaacacgaccgtctggccgggcaccaccgccgagttccggcgggccacccgcgcggtc
gacctggccgagtacgaggtcatccggccgcccgtcccgaacgggccgcggaaggccgtc
ctggccgaggaggccgcgcgatga

DBGET integrated database retrieval system