KEGG   Streptomyces sp. SirexAA-E: SACTE_2641Help
Entry
SACTE_2641        CDS       T01601                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein C
  KO
K03637  
cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Folate biosynthesis
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACTE_2641
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    SACTE_2641
Enzymes [BR:ssx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     SACTE_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2979734..2980234)
Genome map
AA seq 166 aa AA seqDB search
MSTQNRLTHIDEAGAARMVDVSKKDVTARVARASGRVLVSPRVVELLRGEGVPKGDALAT
ARIAGIMGAKRTPDLIPLCHPLAVSGVKVDLSVADDAVEILATVRTTDRTGVEMEALTAV
SVAALTVIDMIKAVDKGAVITDVRVEAKSGGASGDYHRPVPEGPGA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgagtacgcagaacaggctgacgcacatcgacgaggcgggcgcggcccgcatggtcgac
gtgtcgaagaaggacgtcacggcccgggtggcccgggcgagcggccgggtactcgtgtcg
ccgcgtgtcgtcgaactcctgcggggagaaggcgttcccaagggcgacgcgctggccacc
gcgcggatcgccgggatcatgggggccaagcggaccccggacctgatcccgctctgccac
cccctggccgtctccggtgtgaaggtcgatctgagcgtcgccgacgacgcggtggagatt
ctcgccaccgtgaggaccaccgaccgtaccggtgtcgagatggaggcgctgaccgccgtc
tcggtcgccgcgctcacggtgatcgacatgatcaaggcggtcgacaagggcgcggtgatc
acggacgtccgcgtcgaggcgaagtcgggcggtgcgtccggcgactaccaccgcccggtg
ccggaaggccctggggcatga

DBGET integrated database retrieval system