KEGG   Streptomyces sp. SirexAA-E: SACTE_2642Help
Entry
SACTE_2642        CDS       T01601                                 

Definition
(GenBank) molybdenum cofactor synthesis domain protein
  KO
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACTE_2642
Enzymes [BR:ssx01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     SACTE_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2980361..2981707)
Genome map
AA seq 448 aa AA seqDB search
MSSTIWSVDEHLEDILAAVRPLEPIELQLPDAQGCVLVEDVVVEVALPPFDNSSMDGYAV
RVSDVEGAGEEFPAVLTVVGDVAAGDGGLADGRSLAPGEAARIMTGAPLPEGAEAVVPVE
WTDGGTGGGPATAMRAHSEAPEGAGGEVRVHRPVKAGAHVRTRGSDVRPGDLALRAGSVV
GPAQIGLLAAIGRAAVKVRPRPRVVVLSTGSELAQPGEELTGGRIYDSNSFALTAAARDA
GAIAYRVPAVADDAETLRATIEDQLIRADIVVTTGGVSVGAYDVVKEALSSLGHAPGDAA
EGAEGDTDEPAGGVDFRKLAMQPGKPQGFGSIGPDHTPLLALPGNPVSSYVSFELFVRPA
IRTLMGLDDVHRPKVRATLAMDEALSSPPGRRQFLRGRYDAEAGTVTPVGGSGSHLIAAL
AQADALIVLPEDTTSAEPGTETEVILLR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcacgatctggtcggtcgacgagcacctggaagacatcctcgccgcggtccgg
ccgctggagccgatcgagctgcagctgcccgacgcccagggctgcgtcctggtcgaggac
gtcgtggtggaggtcgcgctgcctcccttcgacaacagctcgatggacggttacgcggtc
cgggtctccgatgtcgagggcgccggcgaggagttcccggcggtcctcaccgtcgtcggc
gacgtcgccgcgggcgacggagggctggccgacggccgttcgctcgccccgggggaggcc
gcccgcatcatgaccggcgccccgctgcccgagggcgccgaggcggtcgtcccggtcgag
tggacggacggcggcaccggcggcggccccgccaccgcgatgcgcgcccacagcgaggcc
ccggagggggccggcggcgaggtccgcgtccaccggccggtgaaggccggggcgcacgtg
cggacccggggcagcgacgtacgtccgggggacctggcgctgcgggcgggctcggtcgtc
gggcccgcgcagatcggactgctcgccgcgatcggccgcgcggcggtgaaggtgcggcca
cgcccgcgtgtcgtcgtgctgtccacgggcagtgagctcgcgcagccgggcgaggagctg
accggcggccggatctacgattccaacagcttcgcgctcacagccgcggcccgggacgcc
ggggcgatcgcctaccgggtgcccgccgtcgccgacgacgccgagacgctgcgcgccacc
atcgaggaccagctgatccgggccgacatcgtcgtcaccacgggcggcgtcagcgtcggc
gcgtacgacgtggtcaaggaggccctgtcctccctcgggcacgcaccgggtgacgcggcg
gagggcgcggagggcgacacggacgagccggccggaggggtcgacttccgcaagctcgcc
atgcagccgggcaagccccagggcttcggctcgatcggaccggaccacaccccgctgctg
gccctgccgggcaacccggtctcctcgtacgtctccttcgagctcttcgtacggccggcg
atccggaccctgatgggactcgacgacgtccaccgcccgaaggtccgggccacgctcgcc
atggacgaggcgctctcctcaccgcccggcaggcgtcagttcctgcgcgggaggtacgac
gcggaggccggcaccgtgacaccggtgggcggttccgggtcgcatctgatcgccgccctg
gcccaggccgacgcgctgatcgtgctgcccgaggacacgacctcggccgagcccggcacg
gagaccgaggtgatccttctccgctga

DBGET integrated database retrieval system