KEGG   Streptomyces sp. SirexAA-E: SACTE_2647Help
Entry
SACTE_2647        CDS       T01601                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2988289..2989569
Genome map
AA seq 426 aa AA seqDB search
MATTVSDRPGYGQLLRTPGAWTFLLPGFAARQPFAMLTISIVLLVQHTTGSYGSAGAVAA
VSGVSMALFAPQTGRLADRFGQRAVLLPGVLVHAASVGVLTALALAHAPMWALFLAAVPT
GASIPQVGPMVRARWAARLGAAPGRAASPLMTTAAAFESVTDEFTFVIGPVIATALCTGV
HPAAGLVAEGVLTLVGGIVFAAQRGTQPAPQDAATSAAPHRSALSVPGVRVLAITFLGIG
SVFGGMQVALTAFSEEIGRPGVNGVLYGVFAAGNMLAGIACGAIAWKSGPRRRLIIGYLA
LTVTASGLWAVHSVVLLAGLGLLVGLCIAPALISGYTLVDALVPASARTEAFTWLTGAVA
LGQAAAVTVAGQLADAHGASTGFLVPLGGTLLALATLLTLRSRLVPRAEGRTVARGIGHR
EQVTVD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaccacggtctccgaccgccccggttacgggcagttgctgcgcaccccgggtgcg
tggaccttcctcctcccgggcttcgcggcccggcagcccttcgcgatgctgaccatcagc
atcgtcctgctcgtccagcacaccaccggttcgtacggcagtgcgggcgccgtcgccgcc
gtatcgggcgtctcgatggccctgttcgcaccgcagaccggccggctcgccgaccggttc
ggccagcgcgcggtgctgctgcccggcgtactggtgcacgccgcgtccgtcggcgtactg
acggcgctcgcgctggcgcacgcgcccatgtgggccctgttcctggcggccgtgcccacc
ggggcctcgatcccgcaggtcgggccgatggtccgggcccggtgggcggcacggctcggt
gccgccccgggacgcgcggcctctccgctgatgaccacggccgccgccttcgagtccgtg
acggacgagttcaccttcgtcatcggtccggtgatcgcgacggcgctgtgcaccggcgtg
cacccggcggccggtctggtcgccgagggcgtgctgaccctggtcggcggcatcgtcttc
gccgctcagcgcgggacacagcccgccccgcaggacgcggcgacctccgccgcaccgcac
cgctcggcgctgtccgtgccgggcgtgcgggtcctggcgatcaccttcctgggcatcggc
tccgtcttcggcggcatgcaggtcgccctgacggcgttctccgaggagatcggccgcccc
ggggtcaacggtgtgctgtacggcgtcttcgcggccggcaacatgctcgccgggatcgcc
tgcggagccatcgcctggaagagcggcccgcgccgccggctgatcatcgggtacctggcc
ctgaccgtgaccgcctccggcctctgggccgtgcactccgtggtgctcctggccggactg
ggactcctggtcgggctctgcatcgcacctgctctgatcagcggatacaccctggtcgac
gccctggtgccggcctccgcccggaccgaggccttcacctggctgacgggcgccgtggcc
ctggggcaggccgccgccgtcaccgtggccggacagctcgcggacgcccatggggcgagc
accggtttcctggtaccgctgggcgggacactgctggccctggcgacccttctgaccctg
cgttcgcggctcgtgccccgggccgagggacggacggtggcacgtgggatcggtcaccgc
gagcaggtcacggtggactga

DBGET integrated database retrieval system