KEGG   Streptomyces sp. SirexAA-E: SACTE_2651Help
Entry
SACTE_2651        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2991855..2992079)
Genome map
AA seq 74 aa AA seqDB search
MSTAPAPGPRDPEPPQSQERPSQDSGPRPALVFDDPLDRQSADDTDQAWGERAPVGGGAA
DLARFLDEKPPHHI
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcccccgcccccggaccgcgcgatccggagccgccgcagtcgcaggagcgt
ccgtcacaggactccgggcccaggccggctctggtcttcgacgatccgctggaccggcag
tccgcggacgacacggaccaggcgtggggcgagcgggctccggtcggcggcggcgccgcc
gacctggcgcgcttcctcgacgagaagccgccccaccacatctga

DBGET integrated database retrieval system