KEGG   Streptomyces sp. SirexAA-E: SACTE_2662Help
Entry
SACTE_2662        CDS       T01601                                 

Definition
(GenBank) Phosphinothricin acetyltransferase
  KO
K03823  
phosphinothricin acetyltransferase [EC:2.3.1.183]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Phosphonate and phosphinate metabolism
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    SACTE_2662
Enzymes [BR:ssx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.183  phosphinothricin acetyltransferase
     SACTE_2662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3003638..3004240
Genome map
AA seq 200 aa AA seqDB search
MPQVPADVQVKPGVETDLAALTDLYNHYVRETALTFDTDAFTPEERLPWLRSHPEDGPHR
LLVAWEAAGGPDDGTDTGAASRIVGYATSSPFRAKAAYRTSVEVSVYCAPEAVGRGIGTL
LYQALFEALADEDVHRAYAGIAQPNEPSVRLHAAFGFRHVGTYAEVGRKFGRFWDVSWYE
RPLLSRTAPTSSPDPSRTRR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggtacccgcagatgtgcaggtcaagcctggagtcgagacggatctggcagcc
cttaccgacctctacaaccactacgtccgtgagacggcgctcacgttcgacacggacgcc
ttcacccccgaggagcgtctgccctggttgcgctcccacccggaagacggcccccaccgg
ctgctggttgcctgggaggcggccggcgggccggacgacgggaccgacacgggtgccgcc
tcccggatcgtcggatacgccaccagcagcccgttccgcgccaaggccgcgtaccgcacc
tccgtggaggtgagcgtctactgcgcaccggaggcggtgggcaggggcatcggcaccctg
ctctaccaggccctcttcgaggcgctggccgacgaggacgtccaccgcgcgtacgccggg
atcgcccagccgaacgaaccgtccgtccggctgcacgccgccttcggcttccgccatgtc
ggtacgtacgccgaggtgggccggaagttcggccgcttctgggacgtgtcctggtacgag
aggccgctgctcagccgaactgcaccgacctcttcgccagacccatccagaacccgtcga
tga

DBGET integrated database retrieval system