KEGG   Streptomyces sp. SirexAA-E: SACTE_2668Help
Entry
SACTE_2668        CDS       T01601                                 

Definition
(GenBank) glycosyl transferase family 2
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3010448..3012385
Genome map
AA seq 645 aa AA seqDB search
MPRVKVSVIVPVYNTGKYVDECAPSLLGQSLPDDEYEVIYVDDGSTDDTLTRLEKLAAGH
PNVQVHTQPNSGWPGAPRNVGMEHAKGEYVQFVDHDDMLGTEALERLYEHATRNRADVVI
GKMSSTMVRPRRLFRQTVDACTIENDELMQSMSPHKMFRRAFVEEHGLRFPEGPWIMEDL
AFVSAAYLKAERIAILADYPCYYWMKRDDGGNNTRHRFNPRHGFWPNLRTIVRQFKDGTT
ASDDVDALQNRLLHRLYHVEVLSRAREPEILREDPAEQRQRFAMARQVALEEFPAAVRRG
LPAVSGLRAELLERGDFDGAFAFAEHIRGVKARTELGAPRWEDGCLIADITLELLRGDGE
PLLLTERDGKWWLDPELLTGVSGTKDGWEVGDPFRMAYAEVVVKDRDREDWWYPEGDLEV
ALRPVGDGRSRLVASGRLRLDPQRLAGDRPLGRGVYDVWAFVNLLGIDRMVRVTGHDVSN
EPAAAPAVTGGRLALPYWTTGVGQLTLDVDQRLRRLGPDTAGAAAANAERGERSLPLPYV
VAEPGVPAPLKVTVSALKVTAELVPAADGSTVRLRLPARLKLPAGRHPVTLPKADAPVAH
AVVRDGALLRLEGPAYEAGTGRRLLDAVAGNRQVRRVRRRLGRSS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgccgagagtcaaggtcagcgtcatcgttcccgtgtacaacaccgggaagtacgtcgac
gagtgcgcgccgtcgctgctggggcagagcctgcccgacgacgagtacgaggtcatctac
gtcgacgacgggtcgacggacgacacgttgacgcggctggagaagctggcggccgggcat
ccgaacgtccaggtgcacacccagcccaactccggctggcccggcgccccgcgcaacgtc
ggtatggagcacgccaagggcgagtacgtgcagttcgtcgaccacgacgacatgctcggg
accgaagccctcgagcggctgtacgagcacgcgacgcgcaaccgggccgacgtggtgatc
ggcaagatgtccagcacgatggtgcggccccggcggctgttccggcagacggtggacgcc
tgcacgatcgagaacgacgaactcatgcagagcatgtccccgcacaagatgttccggcgt
gccttcgtcgaggagcacgggctgcgcttccccgagggtccgtggatcatggaggacctg
gccttcgtcagcgccgcctacctcaaggcggagcggatagcgatccttgccgactatccc
tgctactactggatgaagcgggacgacggcggcaacaacacccgccatcgcttcaacccg
cgacacgggttctggcccaacctccgtaccatcgtccgccagttcaaggacggcaccacg
gcgtccgacgacgtcgacgcgttgcagaaccgtctcctgcaccgcctgtaccacgtcgag
gtcctctcccgggcccgtgagcccgagatcctgcgtgaggacccggccgagcagcggcaa
cgcttcgcgatggcccggcaggtggcgctggaggagttcccggccgccgtgcggcggggg
ctgcccgcggtgagcgggctgagggccgaactgctggaacgcggcgacttcgacggggcg
ttcgcgttcgcggagcacatccgcggggtgaaggcccgcaccgagctcggcgcaccgcgc
tgggaggacggctgcctgatcgccgacatcacgctggaactgctgcgcggggacggcgaa
ccgctgctcctgaccgaacgggacgggaagtggtggctggatccggagctgctgaccggc
gtctcggggacgaaggacgggtgggaggtcggcgacccgttccggatggcgtacgccgag
gtggtcgtcaaggaccgtgaccgggaggactggtggtacccggagggcgacctggaggtg
gcgctccggcccgtcggggacggccggtcgcggctcgtcgcctccgggcggctgcggctc
gacccgcagcggctggccggcgaccggccgctgggccgcggggtgtacgacgtgtgggcc
ttcgtcaacctgctgggcatcgaccggatggtccgcgtgaccggtcacgacgtatcgaac
gaaccggcggcggccccggcggtgaccggcggccgtctcgcgctgccgtactggaccacc
ggcgtgggccagctcaccctcgacgtggaccagcgcctgcgcagactcggtcctgacacg
gccggtgccgccgccgcgaacgccgagcgcggcgagcggtcgctcccgctgccgtacgtg
gtggcggagcccggcgtcccggctcccctcaaggtcaccgtgtccgccctgaaggtcacc
gccgagctggtccccgccgccgacgggtcgacggtgcggctgcgtctccccgcccgcctc
aagctgcccgccggacgccatccggtcaccctgccgaaggcggacgccccggtcgctcac
gccgtcgtccgcgacggcgccctgctccgcctggaggggccggcgtacgaggccggcacc
ggacgccggttgctcgacgcggtcgcgggcaaccgccaggtccggcgcgtacggcgacgg
ctgggccggtcgagctga

DBGET integrated database retrieval system