KEGG   Streptomyces sp. SirexAA-E: SACTE_2680Help
Entry
SACTE_2680        CDS       T01601                                 

Definition
(GenBank) ADP-ribosylation/Crystallin J1
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3025969..3027093)
Genome map
AA seq 374 aa AA seqDB search
MSTGTTGTAAVWGRAQQQDFRSRVRGSLLGGAIGDALGAGVSGLTLEAIRAAHGADGVTD
FVAAHGRRGSVTAVTQLTLFTVDGLIRAQVRRDTGAWHPPTDVYRAHLRWAATQNAWGPD
ERRTDNGWLAGEEWLYARRAPTRECIAGFGDATMGTLAVPKNPAARDSAALTRSGPFGLL
VGWEPQLVLQLAVECAAQTHGHATAQLAAGAFALLVHGLARGETLDGSVQRALALLADRP
GSEQVGDALRQALGSVRQGIPGPALIEALGDTDSAEEVLAVALYCALVGEDVRHGLRLAV
NHSGPSAATGAVCGALLGALHGETALPPAWLAELEGRSTVLELADDFAMEMTQGPALHST
TAAAPGWLARYPRG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacagggaccacagggaccgcagctgtctggggccgtgcccagcagcaggacttc
cgcagtcgggtacggggctccctgctcggcggagccatcggggacgcgctcggggccggc
gtctccgggctcaccctggaggccatacgcgccgcccacggggcggacggggtgaccgac
ttcgtcgccgcgcacggcagacgcggcagcgtcaccgccgtcacccagctcaccctcttc
accgtcgacggcctcatacgggcccaggtgcggcgggacaccggtgcctggcacccgccc
accgatgtgtaccgcgcccatctgcgctgggcggccacgcagaatgcctgggggcccgac
gaacgccggacggacaacggctggctggccggtgaggagtggctgtacgcccgccgcgcc
cccacccgtgaatgcatcgccggcttcggtgacgccacgatgggcaccctcgccgtcccc
aagaacccggccgcgcgggactccgccgcgctcacccgctccgggcccttcggtctgctc
gtcggctgggagccgcagctcgtcctccaactggccgtcgagtgcgccgcccagacccac
ggccacgccactgcccagctggcggcgggggccttcgccctcctggtgcacgggctggcc
cgaggcgagaccctggacggctcggtacagcgcgccttggcgctgctcgcggaccgtccg
ggcagcgagcaggtcggcgacgcgttgcggcaggccctcggctccgtacgtcagggcatc
cccgggcccgcgctcatcgaggcgctcggcgacaccgactccgcggaggaggtgctcgcc
gtggcgctgtactgcgccctggtcggagaggacgtacggcacggactgcgcctcgccgtg
aaccactcggggccgtcggccgccaccggggccgtctgcggggcgctcctcggggcgctg
cacggggagacggcgctgccgccggcctggctggccgagctggaagggcgctccaccgtc
ctggaactcgccgacgacttcgccatggagatgacgcagggcccggccttgcacagcacg
accgccgccgcccctggctggctcgcccgctacccccggggctga

DBGET integrated database retrieval system