KEGG   Streptomyces sp. SirexAA-E: SACTE_2684Help
Entry
SACTE_2684        CDS       T01601                                 

Definition
(GenBank) protein of unknown function DUF397
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3029168..3029368
Genome map
AA seq 66 aa AA seqDB search
MSRIPDLGSTTWRKSSYSDGGANNCLEVADGFPGLVPVRDSKTPAGPALLVTASAWADFV
AFAAGR
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaattcccgacctcggaagcacgacctggcgcaagtccagctacagcgacggc
ggagcgaacaactgcctcgaagtcgccgacggcttccccgggctcgtccccgtccgcgac
agcaagacccccgccggaccggccctcctggtgaccgcgtccgcctgggcggacttcgtc
gcgttcgccgccgggcgctga

DBGET integrated database retrieval system