KEGG   Streptomyces sp. SirexAA-E: SACTE_2690Help
Entry
SACTE_2690        CDS       T01601                                 

Definition
(GenBank) Tetracyclin repressor domain protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3034764..3035381)
Genome map
AA seq 205 aa AA seqDB search
MTKKQAEDAARTRLDPGAVVRAALELLDEKGADGLSVRGVADRLGVRMNTVLWHAKTKAR
LLELMADAILAEVSCDGLPEPWELRVRELFHRYRRALLAHRDGARIVAGTYAAEPATLRF
AELTVEALLAGGLEEREAVWTVWTLVYFTLGLTQEEQAQPDALGGAFARRLGAGDYPSLS
RVAPHFEEAAFDERFDYGLSRVLGP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagaagcaagcggaggacgccgcccggacccggctcgaccctggcgcggtggtg
cgggcggccttggagctgctggacgagaagggcgcggacgggctctcggtccggggcgtc
gcggaccggctcggcgtccggatgaacacggtgctctggcacgcgaagaccaaggcgcgc
ctgctggagctgatggccgacgcgatcctggccgaggtgtcctgcgacgggctgcccgag
ccctgggaactccgcgtccgtgagctgttccaccgctaccgccgggccctcctcgcccac
cgggacggggccaggatcgtggccggcacatacgcggccgagcccgccacgctccggttc
gccgagctgacggtggaggcgctgctggccggcgggctggaggagcgcgaggcggtgtgg
acggtctggacgctggtctacttcaccctcgggctgacccaggaggagcaggcgcagccg
gacgcgctgggcggagccttcgcgcgccgcctgggcgcgggtgactacccgtcactgtcc
cgcgtggccccgcacttcgaggaggcggccttcgacgagcgcttcgactacgggctctcc
cgcgtcctcgggccgtga

DBGET integrated database retrieval system