KEGG   Streptomyces sp. SirexAA-E: SACTE_2693Help
Entry
SACTE_2693        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3038052..3038969
Genome map
AA seq 305 aa AA seqDB search
MKITRAVSVLLTGLVVAGCSAGEPDGQGAGQEPPTVKNLTVRTGADIRLPLDSYRLTAEQ
INQFAKASELLAADCMKRYGFTWEVYGGDVAAVKDAPQAERYGLISADFAARYGYHPTPD
TAAEDTGRSFKRKVEPTPEMLMVYGAKGAKTDADWKGAAIPEGGCLGEAERKLEDGAPDS
YVGGEVQNIKNEVFAQVESDPRLKKAMDAWSSCMKSSGYDYKNIWDANNDTRWQQGSTAS
PTEIATATADVECKFKSKLPSVYLSLETAYENQRIDSNAEEMSAFKAGVETRMKNAADIL
AKNPA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcacgcgtgccgtgtcggtactgctcacaggactggtcgtcgcgggctgctcg
gccggggagccggacgggcagggcgccggccaggaaccgcccaccgtgaagaacctgacg
gtgcggaccggtgccgacatccgcctgccgctcgactcctaccgtctgacggcggaacag
atcaaccagttcgccaaggcctccgaactgctcgccgcggactgcatgaagaggtacgga
ttcacctgggaggtctacggcggggacgtcgccgccgtgaaggacgccccccaggcggag
cgctacgggctgatcagcgccgacttcgcggcacgctacggctaccaccccaccccggac
accgctgcggaggacacgggcaggtccttcaagcgcaaggtggaacccactcccgagatg
ctcatggtgtacggcgcgaagggcgccaagaccgacgccgactggaagggtgccgccatt
cccgagggcggatgcctgggagaggccgaacgcaagctcgaggacggcgccccggactcg
tacgtcggcggtgaggtacagaacatcaagaacgaggtgttcgcccaggtcgaatccgat
ccgaggctcaagaaggccatggacgcgtggagctcctgcatgaagtcctcgggatacgac
tacaagaacatctgggacgcgaacaacgacacgcgctggcagcagggatcgacggcttcc
ccgaccgagatcgcgaccgccaccgcagacgtggaatgcaagttcaagtcgaaactcccc
agcgtctacctgtcgctggagacggcgtacgagaaccagcggatcgacagcaacgccgaa
gagatgtccgcgttcaaggcaggtgtcgaaacccggatgaagaacgccgccgacatcctg
gccaagaatcccgcgtaa

DBGET integrated database retrieval system