KEGG   Streptomyces sp. SirexAA-E: SACTE_2694Help
Entry
SACTE_2694        CDS       T01601                                 

Definition
(GenBank) Peptidoglycan-binding domain 1 protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3039019..3040470
Genome map
AA seq 483 aa AA seqDB search
MMVGIFGGRNAVEKGTENRVGPARRKWVAAVVIGAVALTGAGLVASVVIKSPAQALADAG
PPPRDVLTAEVERRVLEDSVIVRGSVTAAQSLEITPTVRGEDGAGAPVVTKLALRTGDTV
KAGQVLFEVSGRPVFALKGKLPVYRDLKPESSGDDVAQLQRALGELGHATGGDRSGFFGA
GTKAALTSFYASVGYEPVPAQADGGSAVAEAQNAVTAAERALEDLRDAAAPTAGQGARKG
ADDDGTAVSRQRAEERALADRDEARQTLADARAADGPMLPAGEVVYMEGFPARVDAVTAK
VGTSVEGPVMTLSAGALVVQGHLQSYQKGLVRVGQKVEILSEVSGVTAAARVELVSSTPE
TGQDQSPSGEAGAAPAAPAAGEYRLEVRPDKPLDTQLVGQDVRLTIQAASTKGKALVVPI
SAISSAADGRTVVTVQEADGTQRRVRVRPGTTGDGYAEIVPQNGDALSVGDKVVTGTDGG
TQR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcggaatcttcggcggtcgcaacgccgttgaaaaaggtacggagaatcgtgtc
ggcccggctcgcaggaagtgggtggcggccgtggtgatcggcgccgtggccctgaccggt
gccggtctggtcgcctccgtcgtgatcaagtcacctgcccaggcgctcgccgacgccggg
ccgccaccgcgggacgtgctgaccgcagaggtggaacgccgcgtgctggaggactcggtg
atcgtgcggggaagcgtcacggccgcacagtcactggagatcacccccaccgtgcgcggt
gaggacggggcgggcgctccggtggtgaccaagctggccctgcggacgggtgacacggtc
aaggcgggccaggtgctcttcgaggtgtccgggcggccggtgttcgcgctcaagggcaag
ctgccggtgtaccgggacctcaagcccgagtcgtccggtgacgacgtggcccagctccag
cgggccctgggcgagctcgggcacgccaccggcggcgaccgctccggcttcttcggcgcc
gggacgaaggccgcgctgacgtccttctacgcgtccgtcggctacgagcccgtacccgcg
caggcggacggcggcagcgccgtggcggaggcgcagaacgcggtgacggctgcggaacgc
gctctggaggacctccgtgacgccgcggccccgaccgccgggcagggcgcgcggaagggt
gccgacgacgacgggacggccgtcagccggcagagggccgaggagcgtgccctggccgac
cgtgacgaggcccggcagaccctcgcggacgcccgggccgccgacggtcccatgctgccg
gccggcgaggtcgtctacatggagggcttccccgcccgcgtcgacgcggtgacggcgaag
gtcggtacctcggtcgaggggccggtcatgaccctgtcggcgggcgcgctcgtggtgcag
gggcatctgcagagctaccagaaggggctcgtccgcgtcggccagaaggtcgagatcctt
tcggaggtcagcggcgtcaccgccgcggcccgggtcgagctggtgtcgagcaccccggag
accggacaggaccagtccccgagcggggaggcgggtgccgctcccgcggcaccggcggcg
ggcgagtaccgcctggaggtccgcccggacaagccgctggacacccagctcgtcggccag
gacgtccgcctgaccatccaggccgcctcgacgaagggcaaggcactggtcgtcccgatc
tccgccatctcctccgcggccgacggcagaaccgtcgtcacggtccaggaagcggacggc
acccagcgccgcgtgcgggtgcgtcccggcaccacgggcgacgggtacgccgagatcgtc
ccgcagaacggcgacgccctgtcggtcggggacaaggtcgtgaccggcaccgacgggggg
acccagcggtga

DBGET integrated database retrieval system