KEGG   Streptomyces sp. SirexAA-E: SACTE_2695Help
Entry
SACTE_2695        CDS       T01601                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02003  
putative ABC transport system ATP-binding protein
Organism
ssx  Streptomyces sp. SirexAA-E
Module
Putative ABC transport system
Brite
Transporters [BR:ssx02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    SACTE_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3040467..3041156
Genome map
AA seq 229 aa AA seqDB search
MTPPAPVIEFRQVGLTYPGPPPVEALRPCDLVIEPGEFVSIVGPSGSGKSTFLNIAGLLD
KPTTGTYLLDGIDTTTLKDSDVTSVRGRRIGFVFQSFHLLPHRSALENVMLAMTYNGVPR
AERAERAREALACVGLGHRVAAMPSTLSGGERQRCAIARALVARPSLLLCDEPTGNLDTA
NTATVLRLLETLHDGGMTVLVITHEPEVAARGSRTVAIRDGLLSEQVMR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgcccgcccccgtcatcgagttccgccaggtcggtctgacgtatcccggtccg
ccccccgtggaggcgctccgcccctgcgacctggtcatcgagccgggcgagttcgtgtcg
atcgtcggcccctcggggtccggcaagtcgaccttcctcaacatcgccggactcctggac
aaaccgaccacggggacctacctcctggacgggatcgacaccacgacgctcaaggacagc
gatgtgacgtcggtgcgcggccggcgcatcggcttcgtcttccagtccttccacctgctc
ccccaccgctcggcgctggagaacgtcatgctcgccatgacctacaacggcgtaccccgt
gcggagcgggcggagcgggcgcgggaggcgctggcgtgcgtggggctcggccaccgtgtc
gcggccatgcccagcacgctctccggcggggagaggcaacgctgcgccatagcgcgggcc
ctggtggcccggccctccctgctgctgtgcgacgagcccaccggcaacctcgacaccgcc
aacaccgccacggtgctcaggcttctggagacccttcacgacgggggcatgaccgtcctg
gtcatcacccatgagccggaggtggcggcccggggcagccggaccgtggccatccgcgac
ggcctgctgagcgagcaggtgatgaggtga

DBGET integrated database retrieval system