KEGG   Streptomyces sp. SirexAA-E: SACTE_2696Help
Entry
SACTE_2696        CDS       T01601                                 

Definition
(GenBank) protein of unknown function DUF214
  KO
K02004  putative ABC transport system permease protein
Organism
ssx  Streptomyces sp. SirexAA-E
Module
ssx_M00258  Putative ABC transport system
Brite
Transporters [BR:ssx02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    SACTE_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD FtsX
Motif
Other DBs
NCBI-ProteinID: AEN10579
UniProt: G2NKZ7
Position
3041153..3042403
Genome map
AA seq 416 aa AA seqDB search
MKRFRTGRRGDPAIPSSVFGARDILAESVAGMLQRPARSALTTLGTVLGVGTFVAILGLT
ATTSSQIDSRFNLLSATEVTVEDVAREQDEFADAAFPDDADATIEGLNGVEHAGVFWSVR
LPPGSTVKSSPVGDAAVGEKIDVVAASPGALRAAVPTLAQGRLFDTYLSETSQPVAVIGS
GMASRLGITTLQTQPAIFIGDTPFTVIGIVSDVRRKADLLLSVVVPGTTAEKVWGHPADA
GTKMLISTEAGAARQVSELAPTALRPDHPEYLKVIPPPDPKALRTSVTSDLNQLFLLLAA
ICLVIGAVGIANTTLVAVLERTGEIGLRRALGARGRHITVQFLAESGTLGALGGLVGTSL
GTITVVIVAVVREWTPVIHTATVAAAPVIGLVTGLVAGLYPAWRASRVPPAEALRR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggttccgcaccggccggcgcggcgacccggccatcccgtcgtcggtcttcggg
gcgcgcgacatcctggccgagtccgtcgcgggcatgctgcagcggcccgcccgctcggcc
ctgaccaccctgggcacggtcctgggcgtcggcaccttcgtggcgatcctggggctcacc
gcgaccacgtcctcccagatcgattcccggttcaatctgctgtccgccaccgaggtgacg
gtcgaggacgtcgcccgggagcaggacgagttcgcggacgccgccttccccgacgacgcc
gacgccacgatcgagggtctcaacggggtggagcacgcgggggtgttctggagcgtccgg
ctgcccccggggtcgacggtcaagtcctcccccgtcggggacgccgccgtgggcgagaag
atcgacgtcgtcgccgcctccccgggcgcgctgcgagcggccgttcccaccctcgcccag
ggacggctcttcgacacctacctctccgagacctcccagcccgtcgccgtcatcggctcg
ggcatggcgtcacggctgggcatcacgaccttgcagacccagccggccatcttcatcggc
gacacccccttcaccgtcatcggcatcgtctccgacgtccggcgcaaggccgatctgctg
ctgtcggtcgtggtgcccggcaccacggcggagaaggtgtggggccatcccgcggacgcc
gggacgaagatgctgatctccaccgaggcgggcgccgcccggcaggtctccgaactcgcc
ccgacggcgctgcgcccggaccatcccgagtacctgaaggtgataccgccgcccgacccc
aaggccctgcggacgagtgtcacctcggacctcaaccagctcttcctgctgctggcggcc
atctgcctggtgatcggtgccgtcggcatcgccaacacgacgctcgtcgcggtcctcgaa
cgcaccggtgagatagggctccgccgggccctgggcgcgcgggggcggcacatcaccgtt
cagttcctcgccgagtccggcacgctcggcgcactgggcgggctcgtcgggaccagcctc
ggcacgatcacggtggtgatcgtggccgtcgtacgggagtggacgccggtgatccacacg
gccaccgtcgccgccgcacccgtcatcggtctcgtcaccggtctggtcgccggcctgtac
cccgcctggcgggccagccgggtaccgccggccgaggccctccggcgctga

DBGET integrated database retrieval system