KEGG   Streptomyces sp. SirexAA-E: SACTE_2703Help
Entry
SACTE_2703        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3050209..3050394
Genome map
AA seq 61 aa AA seqDB search
MPTVIHRTRSELVEQRERLLADVHMSYEELAERAATYSLSLRELDVWHTIEGLDYLLDGD
S
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgccgactgtgatccataggacgcgcagcgagcttgtggagcagcgtgagaggctgctg
gctgacgtccacatgagctatgaagagctggcggagcgcgcggcaacatacagtctcagc
ctgcgcgagctggacgtttggcacaccatcgaaggactcgactaccttcttgacggtgac
agctga

DBGET integrated database retrieval system