KEGG   Streptomyces sp. SirexAA-E: SACTE_2847Help
Entry
SACTE_2847        CDS       T01601                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACTE_2847
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SACTE_2847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3197491..3198102
Genome map
AA seq 203 aa AA seqDB search
MTAFSTEGQSDPTVQPVPAAVVEQVDAADVTLSNPKRAVIALGSNLGNRLETLQGAIDAL
EDTPGLRVKAVSPVYETEPWGVDPGSQPSYFNAVIVVKTTLPPSSLLERGQAIEEAFERV
REERWGPRTLDVDIVSYADVVSDDPLLTLPHPRAHERAFVLAPWHDVEPEAQLPGSGTVA
DLLAGVGSDGVLPRADLELRLPE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgttttccaccgaggggcagagcgacccgaccgtccagccggttcccgccgca
gtcgtcgagcaggtggacgcggcggacgtcaccctctcgaaccccaaacgggccgtgatc
gccctcggctcgaacctcggcaaccgcctggagaccctccagggcgccatcgacgccctg
gaggacacccccgggctgcgggtcaaggccgtctccccggtgtacgagacggagccctgg
ggcgtcgacccgggctcccagccgtcgtacttcaacgcggtgatcgtcgtgaagacgacc
ctgccgccgtcctccctgctggaacgcggccaggccatcgaggaggccttcgagcgggtc
cgcgaggagcgctggggccccaggaccctcgacgtcgacatcgtgtcgtacgccgacgtg
gtctccgacgacccgctgctgacccttccgcacccgcgcgcccacgagcgcgccttcgtc
ctcgccccctggcacgacgtggagcccgaggcccagctgcccggctccggcacggtcgcc
gacctgctggccggcgtcggcagcgacggggtgcttccccgggccgacctggaactccgc
ctgcccgagtag

DBGET integrated database retrieval system