KEGG   Streptomyces sp. SirexAA-E: SACTE_2849Help
Entry
SACTE_2849        CDS       T01601                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ssx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3198755..3199360)
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGQGSIGVFDEKRAEAAVRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLH
QEPEDVLTTTFDLGHDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPATSGKITGLSKLA
RLVDVYARRPQVQERLTTQVAESLMSILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSA
VRGQLRDPATRAEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccgtgacgctcgacgggcagggctcgatcggcgttttcgacgagaagcgg
gccgaggccgccgtacgggagctcctcatcgcggtcggggaggacccggaccgtgagggg
ctgcgggagacgccggggcgggtggcgcgggcctacaaggagatattcgcgggtctccac
caggaacccgaggacgtcctgacgacgaccttcgacctcggccacgacgagatggtgctg
gtcaaggacatcgaggtgttcagcacctgcgagcaccacctggtgccgttccgcggcgtc
gcgcacgtcgggtacatcccggccaccagtggcaagatcacgggactgtcgaagctggcc
cggctggtcgatgtctacgcccggcggccccaggtccaggagcggctgaccacgcaggtc
gccgagtcattgatgtccatcctggagccgcgcggggtcatcgtggtcgtggagtgcgag
cacatgtgcatgtcgatgcgcggtatccgcaagcccggggcgaagacgctcacctcggcc
gtccggggccagctgcgcgaccctgccacccgtgcggaggcgatgagcctcatcatggcg
cgctga

DBGET integrated database retrieval system