KEGG   Streptomyces sp. SirexAA-E: SACTE_3054Help
Entry
SACTE_3054        CDS       T01601                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3411410..3412009)
Genome map
AA seq 199 aa AA seqDB search
MYEGVVQELIDELGRLPGVGPKSAQRIAFHVLQAEPTDVRRLAHALLEVKDKVRFCEVCG
NVAQQEQCAICRDARRDRTVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIEGVGPDD
LRIRELLARLADGTITELILATDPNLEGEATATYLARMVKPMGLRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaggcgtggtgcaggagctgatcgacgaactgggcaggctgcccggcgtcggt
cccaagagcgcgcagcggatcgccttccacgtcctgcaggcggagcccaccgacgtacgc
cgactggcccacgccctcctcgaggtcaaggacaaggtccgcttctgcgaggtctgcggc
aacgtggcgcagcaggagcagtgcgccatctgccgggacgcgcgccgtgaccggacggtc
atctgcgtggtcgaggagcccaaggacgtcgtcgcgatcgagcggacccgggaattccgg
ggccgctaccacgtgctcggcggcgcgatcagcccgatcgagggcgtcggccccgacgac
ctgcgcatccgggagctgctggcccggctcgcggacggcacgatcacggagctgatcctg
gccacggaccccaacctggagggcgaggccaccgcgacctacctcgcccgcatggtgaag
cccatgggcctgcgggtgacccggctggccagcggcctgccggtgggcggcgacctggag
tacgccgacgaggtcaccctcggccgcgcgttcgaggggaggcggctgctcgatgtgtga

DBGET integrated database retrieval system