KEGG   Streptomyces sp. SirexAA-E: SACTE_3308Help
Entry
SACTE_3308        CDS       T01601                                 

Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  
chromosomal replication initiator protein
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SACTE_3308
DNA replication proteins [BR:ssx03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SACTE_3308
Chromosome [BR:ssx03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    SACTE_3308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3691245..3692978)
Genome map
AA seq 577 aa AA seqDB search
MLDQLLGEGQQGIEPKDKQWIERCQPLALVADTALLAVPNEWGKRVLEGRLAPLISETLT
RECGRPIRIAITVDDSANEPPTPPAPPMHQQHQSQGQQPHHYQGPQRDEQPRNDVYDGYG
HRPSDDGMPTARPAYPDYQQQRPGAWPRSQEDLSWQPRHGGYQDMDPYASTRPQQPQHDY
RPQPPERQGYEPQRDGRDRHDMQEQQPPHHQGGHGRAGGPPGSQSAPAPGTNEPHARLNP
KYLFDTFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGESGLGKTHLLHAIGHYARSLYP
GTRVRYVSSEEFTNEFINSIRDGKGDTFRKRYRDVDILLVDDIQFLASKESTQEEFFHTF
NTLHNANKQIVLSSDRPPKQLVTLEDRLRNRFEWGLTTDVQPPELETRIAILRKKAVQEQ
LNAPPEVLEFIASRISRNIRELEGALIRVTAFASLNRQPVDLGLTEIVLKDLIPGGEDTA
PEITAPAIMASTADYFGLTVEDLCGSSRSRVLVTARQIAMYLCRELTDLSLPKIGAQFGG
RDHTTVMHADRKIRALMAERRSIYNQVTELTNRIKNG
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgctggaccaactcctcggggagggtcagcagggcatcgagccgaaggacaagcagtgg
atcgagcgctgccagccgctggccctcgtggcggacaccgcgctgctggccgtgcccaac
gagtggggcaagcgcgtcctggagggccggctcgcgccactgatcagcgagacgctgacc
cgtgagtgcgggcgcccgatccggatcgcgatcacggtcgacgactccgcgaacgagccg
cccaccccgcccgcgccgcccatgcaccagcagcaccagtcccagggacagcagccccac
cactaccaggggccgcagcgggacgagcagccgcgcaacgacgtgtacgacggctacggg
caccgcccgtccgacgacggcatgcccacggcccgtcccgcctacccggactaccagcag
cagcgccccggtgcctggccgcgcagccaggaggacctgtcctggcagccccggcacggc
ggctaccaggacatggacccgtacgcgagcacgcgcccccagcagccgcagcacgactac
cgtccgcagccgccggagcgccagggctacgaaccgcagcgcgacggacgcgaccgccac
gacatgcaggagcagcagcctccgcaccaccagggcggacacgggcgggccggcggcccg
cccggctcgcagtccgcgccggccccggggacgaacgagccccatgcccggctgaacccg
aagtacctcttcgacaccttcgtcatcggcgcgtccaaccgcttcgcgcacgccgcggcg
gtcgccgtggccgaggctcccgcgaaggcgtacaaccccctgttcatctacggggagtcg
gggctgggcaagacccacctcctgcatgccatcgggcactacgcgcgcagtctctacccg
ggcacccgggtgcggtacgtgagctccgaggagttcaccaacgagttcatcaactcgatc
cgcgacggcaagggcgacaccttccgcaagcggtaccgcgacgtggacatcctcctggtc
gacgacatccagttcctggcgagcaaggagtcgacgcaggaggagttcttccacaccttc
aacacgctccacaacgccaacaagcagatcgtgctctcctctgaccggccgcccaagcag
ctggtgacgctggaggaccggctccgcaaccgcttcgagtggggcctgaccaccgatgtg
cagccgcccgagctggagacgcgtatcgcgatcctgcggaagaaggcggtgcaggagcag
ctcaacgcaccgccggaggtgctcgagttcatcgcctcgcggatctcgcgcaacatccgc
gaactggagggcgcgctcatccgcgtgaccgccttcgccagcctcaaccgccagccggtg
gacctggggctgaccgagatcgtgctcaaggacctgatcccgggcggcgaggacaccgcg
cccgagatcaccgctccggccatcatggcttccaccgccgactacttcgggctgacggtg
gaggacctctgcggatcctcgcgcagccgcgtcctggtgacggcgcgccagatcgccatg
tacctctgcagggagctcaccgatctctccctgcccaagatcggggcgcagttcggcggc
cgcgaccacacgaccgtcatgcacgccgaccggaagatccgcgcgctgatggcggagcgc
cgctccatctacaaccaggtcaccgagctcaccaaccgcatcaagaacggctga

DBGET integrated database retrieval system