KEGG   Streptomyces sp. SirexAA-E: SACTE_3666Help
Entry
SACTE_3666        CDS       T01601                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACTE_3666
   01230 Biosynthesis of amino acids
    SACTE_3666
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_3666
  Energy metabolism
   00680 Methane metabolism
    SACTE_3666
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACTE_3666
Enzymes [BR:ssx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SACTE_3666
Exosome [BR:ssx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SACTE_3666
  Exosomal proteins of melanoma cells
   SACTE_3666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4082204..4082965)
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNAKNLFTGWVDVDLTDKGEKEAVRGGELLKDAGLLPDVVHTS
LQKRAIRTAQLSLEAADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPALEDGTEFSQSDDARYATIPPELRPRTECLKDVVIRMMPYWYDGIVPDLLTGRT
VLVAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLTYELDADFRPLNPGGTYLDPEAAK
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgaatggaacgcg
aagaacctgttcaccggttgggtggacgtagacctcaccgacaagggagagaaggaggcg
gtccgcggcggtgagctgctcaaggacgccggcctgctcccggacgtcgtgcacacctcc
ctccagaagcgcgcgatccgcaccgcccagctctcgctggaggcggccgaccgccactgg
atccccgtgcaccgctcctggcgcctgaacgagcgccactacggcgccctccagggcaag
gacaaggcgcagacgctcgccgagttcggcgaggagcagttcatgctctggcgccgctcg
tacgacaccccgccgccggcgctcgaggacggcaccgagttctcgcagagcgacgacgcc
cgctacgcgacgatcccgccggagctgcgcccgcgcacggagtgcctcaaggacgtcgtc
atccggatgatgccgtactggtacgacggcatcgtcccggacctgctgacgggccgcacg
gtcctggtcgccgcccacggcaacagcctgcgcgccctggtcaagcacctggacggcatc
tccgacgccgacatcgcgggcctcaacatcccgaccggcatcccgctcacctacgagctg
gacgccgacttccgccccctgaacccgggcgggacgtacctcgacccggaggcggcgaag
gccgcgatcgaggccgtgaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system