KEGG   Streptomyces sp. SirexAA-E: SACTE_3713Help
Entry
SACTE_3713        CDS       T01601                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssx01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ssx00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ssx00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4128847..4130145
Genome map
AA seq 432 aa AA seqDB search
MAVQTVAANDNASTVDLGPAAALSCRECGERFPLGPIFACVSCFGPLEVAYDLPSGSPEE
LKKRIAEGPDNIWRYAPLLPVPSDVADKPNINPGFTKLVKADNLARELGVTGGLYVKDDS
GNPTHSFKDRVVAIAVEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPHDLEQ
GKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPLGEGWGFVNVNLRPYYGEGSKTLAYE
ICEQLGWRLPDQIVIPIASGSQLTKIDKGLQELIKLGLVEDRPYKIFGAQAEGCSPVSAA
FKGGHDVVRPQKPDTIAKSLAIGNPADGPYVLDIARRTGGAVEDVNDEQIVDAIKLLART
EGIFAETAGGVTVGVTKKLIDAGLLDPALTTVVLNTGDGLKTLDAVAPTTGLSATIRPSL
DAFRDAGLAAAH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcagacagttgcagcgaacgacaacgcctccaccgtggacctcggtcccgcc
gcggcgctttcctgccgcgaatgcggtgagcgtttccccctcggtcctattttcgcctgt
gtgtcctgtttcgggccactcgaagtggcctacgacctgccgagcggctcccccgaggag
ctgaagaagcgcatcgcggagggcccggacaacatctggcgctacgcgccgctgctgccc
gtcccgtccgacgtggcggacaagcccaacatcaaccccggtttcaccaagctggtcaag
gccgacaacctggcccgtgaactgggcgtcaccggcggtctgtacgtcaaggacgactcc
ggcaacccgacgcactccttcaaggaccgtgtcgtcgcgatcgccgtcgaggccgcccgt
gccttcggattcaccacgctctcctgctcctcgaccggcaacctcgccggtgccgtgggc
gccgccgcggcccgcgccggcttccgctcctgcgtcttcatcccgcacgacctggagcag
ggcaaggtcgtcatggccgcggtgtacggcggcgaactggtcggcatcgagggcaattac
gacgacgtcaaccgcttctgctcggagctcatcggcgacccgctcggcgagggctggggc
ttcgtcaacgtcaacctccggccgtactacggcgagggttccaagaccctggcgtacgag
atctgcgagcagctcggctggcggctgcccgaccagatcgtcatcccgatcgcgtccggc
tcgcagctgacgaagatcgacaaggggctccaggagctgatcaagctcggtctggtcgag
gacaggccctacaagatcttcggcgcccaggccgagggctgctccccggtctccgccgcc
ttcaagggcggccacgacgtggtgcgcccgcagaagccggacaccatcgccaagtccctg
gcgatcggaaacccggccgacggcccgtacgtcctggacatcgcccggcgcaccggcggc
gcggtggaggacgtgaacgacgagcagatcgtcgacgcgatcaagctgctggcccggacc
gagggcatcttcgccgagaccgcgggcggggtgacggtcggcgtgacgaagaagctgatc
gacgcgggcctgctcgacccggcgctgaccaccgtcgtcctgaacaccggggacgggctc
aagacgctcgacgcggtcgccccgaccacgggcctgtcggccacgatccggcccagcctg
gacgcgttccgcgacgccggcctcgccgccgcccactga

DBGET integrated database retrieval system