KEGG   Streptomyces sp. SirexAA-E: SACTE_3866Help
Entry
SACTE_3866        CDS       T01601                                 

Definition
serine/threonine protein kinase
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4292701..4294362
Genome map
AA seq 553 aa AA seqDB search
MQPLEAGEPHTIGAYRLIGRLGAGGMGRVYLGRSAGGRTVAVKVVHPHFALDEQFRARFR
REVEAARRVGAQWTAPVLDADPDAPVPWVATGYVAGPPLSDAVTRHGPLPTPAVRALGAG
LGEALAAVHAHGLIHRDVKPSNVLLALDGPRLIDFGIARALGATVSLTSTGVSVGSPGYM
APEQIRGLDISGAADVFSLGAVLAYAGTGNDPFPGDSSAVLLYKVVHEEPELGDLEGELR
ELVAGCLAKDPADRPAPAELARRLAPGGAAALVAPGWLPEPLVREVSRSAVALLDLEPQD
EPVRSGPVPFSSVSPVNTALGSFGPPLPPPPSAAPALGPYGAAGPGEPGARIGFSLGAGA
GAGERRGRRISCTVALAVAGALAAVTVGATMLGDLFPGGDDDRHGNEGAAPPAATGSEAP
GPSASAAAPVKALPDAFVGTWKGSATERSGLPHGTVTAVFTEGARGEDVVRLTHRLDVLG
TSVVCKGIGTLVSGTATELRIRERTDPENADGALCTGGDADLDFTLTSRTTLRYESHEEA
AGTPKGTLTRSGG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgctggaagccggcgaaccgcacacgatcggcgcctaccggctgatcggcagg
ctcggcgcgggtgggatgggccgggtctatctggggcgcagcgccggggggcgcaccgtc
gcggtcaaggtcgtccacccccacttcgccctcgacgagcagttccgggcccgcttccgg
cgtgaggtggaggccgcgcgccgggtcggcgcgcagtggaccgcccccgtcctggacgcc
gacccggacgcgccggtgccgtgggtggcgaccggctacgtggccgggccaccgctctcc
gacgcggtcacccgccacggtccgctgcccacgccggcggtacgggccctgggggccgga
ctcggcgaggcgctcgccgccgtgcacgcgcacggcctcatccaccgggacgtgaagccg
tccaacgtcctgctcgcgctcgacgggccccggctgatcgacttcgggatcgcccgcgcc
ctcggtgccaccgtctccctcacctccaccggggtctccgtcggctcgcccggctacatg
gcgccggagcagatccggggcctggacatctccggagcggccgacgtcttctcgctcggg
gcggtcctcgcctacgcggggaccggcaacgaccccttccccggcgactcgtccgccgta
ctcctctacaaggtggtgcacgaggaacccgaactgggggacctggagggcgaactgcgg
gagctggtggccgggtgcctcgccaaggaccccgccgaccggcccgcccccgcggagctc
gcccgcaggctcgcgcccggcggggccgccgccctggtggcgccgggctggctgccggaa
ccgctggtgcgggaggtcagccggtcggcggtggccctgctggacctggagccgcaggac
gagccggtgcggtccgggccggtgcccttcagcagcgtgtcaccggtgaacacggcactc
ggcagcttcggcccgccgctgccgcccccgccgtccgccgcaccggccctggggccctac
ggcgcggcgggccccggggagcccggggcccggatcggcttctccctgggcgccggcgcg
ggggccggggagcggcgtggccgccggatcagctgcaccgtggcgctcgccgtggccggc
gcgctggccgccgtcaccgtcggcgcgacgatgctgggcgacctgttcccgggcggggac
gacgaccgccacggaaacgagggggcagcgccgcccgcggctaccggatccgaggccccg
ggcccctccgcctccgcggcggcaccggtgaaggcgctgcccgacgcgttcgtcggcacc
tggaagggctccgccaccgagcgcagcggactgccgcacggcacggtcaccgccgtcttc
accgagggcgcgcggggcgaggacgtggtccggctgacgcaccggctcgacgtgctcggc
accagcgtggtctgcaagggcatcggcaccctcgtctccggtacggccacggagttgagg
atccgcgaacggaccgaccccgagaacgccgacggcgccctgtgcaccggcggtgacgcc
gacctcgacttcaccctgacctcccgcaccaccctgcgctacgagtcgcacgaggaggcc
gcgggcacgccgaagggcacgctcacccggtccggcggctga

DBGET integrated database retrieval system