KEGG   Streptomyces sp. SirexAA-E: SACTE_4048Help
Entry
SACTE_4048        CDS       T01601                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SACTE_4048
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SACTE_4048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4476875..4478713
Genome map
AA seq 612 aa AA seqDB search
MPQDSPAQKPAARAVPAADDAAYDYDVLVVGSGFGGAVSALRLSEKGYRVGVLEAGRRFT
RETLPKNSWDIKNYLWAPALGLFGIQRVHLLGKVMVLAGAGVGGGSLNYANTLYVPPAPF
FEDRQWAGITDWQDELAPYYDQAKRMLGVRLNPTMTPADVHLRAAAETMGVGDTFHFAPV
GVFFGDGQDADGASRAKPGAEVPDPYFGGAGPARRACSECGECMTGCRHGAKNTLNENYL
HLAQKAGAVIHPMTSVVAVTDDPDGGYRVSTVPTHRRRKARPTVLRARRVVVAAGTYGTQ
TLLHTMKDQGLLPRISARLGELTRTNSEGLVGAQTSDRRYRKKHGIAKADFTKGVAITSS
VHPDENTHIEPVRYGRGSNAMGALTVLQVPYSSHRVLAWLGNVAKHPLLTMRSLSNRRWS
ERTIIGLVMQSLDNSLTAYRKPGGIGKGLLTARQGHGAPNPTQIAEATQGATLLAQEING
FAGSNIGELMGTPLTAHFLGGCPIGASAETGVIDPYHRLYGHPGISVVDGSAVSANLGVN
PSLTITAQAERAMSFWPNKGEDDPRPAQDEAYARLAAVEPQAPAVPEEAFGALRLPFLGI
PVVPPKQAATDA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggacagccctgcccagaaaccggccgcccgggccgtcccggcggccgacgac
gccgcgtacgactacgacgtcctcgtcgtcggatcgggcttcggcggcgcggtctcggcc
ctgcggctgagcgagaagggataccgggtcggcgtcctggaggcggggcgccgcttcacc
cgcgagaccctccccaagaactcctgggacatcaagaactacctgtgggccccggcgctg
ggcctcttcggcatccagcgggtgcatctgctcggcaaggtgatggtgctggccggcgcg
ggggtcggcggcggatcactcaactacgccaacaccctgtacgtgccgcccgcgccgttc
ttcgaggaccgccagtgggccggcatcaccgactggcaggacgagctggccccctactac
gaccaggcgaagcggatgctgggggtgcggctgaacccgaccatgacccccgcggacgtc
cacctcagggccgccgccgagacgatgggcgtcggcgacaccttccacttcgccccggtc
ggcgtcttcttcggcgacggccaggacgccgacggcgcctcgcgggcgaagcccggcgcg
gaggtccccgacccctacttcggaggcgcgggcccggcccgccgggcctgctccgaatgc
ggcgagtgcatgacgggctgccgccacggggcgaagaacaccctcaacgagaactacctc
cacctggcacagaaggccggcgcggtcatccacccgatgacgtccgtcgtcgccgtcacc
gacgacccggacggcggctaccgggtgtcgaccgtgcccacccaccgccgccgcaaggcg
aggcccaccgtgctgcgcgcccgcagggtggtcgtggcggcgggcacgtacggcacccag
accctgctgcacaccatgaaggaccagggcctgctgccgaggatctcggcgcggctcggt
gaactgacccggaccaactccgagggcctggtcggggcacagaccagcgaccgccgctac
cggaagaagcacgggatcgcgaaggccgacttcaccaagggcgtcgccatcacctcctcg
gtccaccccgacgagaacacccacatcgaacccgtgcggtacggcaggggctccaacgcc
atgggggcgctgaccgtcctccaggtcccctacagctcgcaccgggtgctggcctggctc
ggcaacgtcgccaagcacccgctgctgacgatgcgttcgctgtccaaccggcgctggtcg
gagcggaccatcatcgggctcgtcatgcagtcgctggacaactccctgacggcgtaccgc
aagcccggaggcatcgggaaggggctgctcaccgcccggcagggccacggcgccccgaac
ccgacgcagatcgcggaggcgacccagggcgccaccctgctcgcccaggagatcaacggc
ttcgccgggtccaacatcggggagctgatggggaccccgctcaccgcgcacttcctcggc
ggctgcccgatcggggcgagcgcggagaccggtgtcatcgacccgtaccaccggctctac
gggcacccggggatctcggtggtcgacggctcggcggtctccgccaacctcggcgtcaac
ccgtcactgaccatcaccgcgcaggcggaacgggccatgtcgttctggcccaacaagggc
gaggacgacccgcgcccggcacaggacgaggcctacgcgcggctggcggcggtcgagccg
caggcgcccgcggtgcccgaggaggcgttcggagcgctgaggctgccgttcctggggatc
ccggtcgtccccccgaagcaggccgccaccgacgcctga

DBGET integrated database retrieval system