KEGG   Streptomyces sp. SirexAA-E: SACTE_4072Help
Entry
SACTE_4072        CDS       T01601                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACTE_4072
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACTE_4072
   00640 Propanoate metabolism
    SACTE_4072
   00660 C5-Branched dibasic acid metabolism
    SACTE_4072
Enzymes [BR:ssx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SACTE_4072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4510316..4511497
Genome map
AA seq 393 aa AA seqDB search
MDLFEYQARDLFAKHGVPVLAGEVIDTPEAAREATERLGGKSVVKAQVKVGGRGKAGGVK
LAADPDEAVARATDILGMDIKGHTVHKVMIAELSPEIEAEYYVSYLLDRTNRTFLAMASV
QGGMDIEEVAEKTPEALAKVPVNAVDGVDIAKAREIVAQAKFPADVAEGVAEALVTLWDT
FVAEDALLVEVNPLVKTKDGRILALDGKVSLDENADFRQPGHEALEDKAAANPLEAAAKA
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGDVKPANFLDIGGGASAEVMANGL
EIILGDPDVRSVFVNVFGGITACDEVANGIVQALELLKTKGEDVTKPLVVRLDGNNAELG
RKILSDANHPLVQRVDTMDGAADKAAELAAAAK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacggtgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcagcccgcgaggcgaccgagcggctgggcggc
aagtccgtcgtcaaggcgcaggtgaaggtcggcggccgaggcaaggccggcggcgtcaag
ctggccgccgaccccgacgaggcggtcgcccgggcgaccgacatcctcggcatggacatc
aagggccacacggtccacaaggtgatgatcgccgagctgtccccggagatcgaggcggag
tactacgtctcgtacctcctcgaccgcaccaaccgcaccttcctggccatggcctcggtg
cagggcggcatggacatcgaggaggtcgcggagaagacccccgaggccctcgcgaaggtc
ccggtcaacgccgtggacggggtcgacatcgccaaggcccgcgagatcgtggcccaggcg
aagttcccggccgacgtggccgagggtgtcgccgaggccctggtgaccctgtgggacacc
ttcgtcgccgaggacgccctcctcgtcgaggtcaacccgctggtgaagaccaaggacggc
cgcatcctggcgctggacggcaaggtgtctctcgacgagaacgccgacttccgccagccc
ggccacgaggccctcgaggacaaggccgcggccaacccgctcgaggccgctgccaaggcc
aagaacctcaactacgtcaagctcgacggcgaggtcggcatcatcggtaacggtgccggt
ctggtcatgtcgaccctggacgtcgtcgcgtacgccggtgagaagcacggcgacgtgaag
cccgccaacttcctcgacatcggtggcggcgcctccgccgaggtcatggcgaacggcctg
gagatcattctcggggacccggacgtccggtccgtcttcgtcaacgtcttcggtggcatc
accgcctgcgacgaggtcgccaacggcatcgtccaggctctggagctgctcaagaccaag
ggcgaggacgtcaccaagccgctggtcgtgcgcctcgacggcaacaacgcggaactgggt
cgcaagatcctctccgacgccaaccacccgctcgtgcagcgcgtggacaccatggacggc
gcggccgacaaggccgccgagctcgccgcggctgcgaagtaa

DBGET integrated database retrieval system