KEGG   Streptomyces sp. SirexAA-E: SACTE_4072Help
Entry
SACTE_4072        CDS       T01601                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00020  Citrate cycle (TCA cycle)
ssx00640  Propanoate metabolism
ssx00660  C5-Branched dibasic acid metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
Module
ssx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACTE_4072
   00640 Propanoate metabolism
    SACTE_4072
   00660 C5-Branched dibasic acid metabolism
    SACTE_4072
Enzymes [BR:ssx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SACTE_4072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEN11912
UniProt: G2NFE1
Position
4510316..4511497
Genome map
AA seq 393 aa AA seqDB search
MDLFEYQARDLFAKHGVPVLAGEVIDTPEAAREATERLGGKSVVKAQVKVGGRGKAGGVK
LAADPDEAVARATDILGMDIKGHTVHKVMIAELSPEIEAEYYVSYLLDRTNRTFLAMASV
QGGMDIEEVAEKTPEALAKVPVNAVDGVDIAKAREIVAQAKFPADVAEGVAEALVTLWDT
FVAEDALLVEVNPLVKTKDGRILALDGKVSLDENADFRQPGHEALEDKAAANPLEAAAKA
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGDVKPANFLDIGGGASAEVMANGL
EIILGDPDVRSVFVNVFGGITACDEVANGIVQALELLKTKGEDVTKPLVVRLDGNNAELG
RKILSDANHPLVQRVDTMDGAADKAAELAAAAK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacggtgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcagcccgcgaggcgaccgagcggctgggcggc
aagtccgtcgtcaaggcgcaggtgaaggtcggcggccgaggcaaggccggcggcgtcaag
ctggccgccgaccccgacgaggcggtcgcccgggcgaccgacatcctcggcatggacatc
aagggccacacggtccacaaggtgatgatcgccgagctgtccccggagatcgaggcggag
tactacgtctcgtacctcctcgaccgcaccaaccgcaccttcctggccatggcctcggtg
cagggcggcatggacatcgaggaggtcgcggagaagacccccgaggccctcgcgaaggtc
ccggtcaacgccgtggacggggtcgacatcgccaaggcccgcgagatcgtggcccaggcg
aagttcccggccgacgtggccgagggtgtcgccgaggccctggtgaccctgtgggacacc
ttcgtcgccgaggacgccctcctcgtcgaggtcaacccgctggtgaagaccaaggacggc
cgcatcctggcgctggacggcaaggtgtctctcgacgagaacgccgacttccgccagccc
ggccacgaggccctcgaggacaaggccgcggccaacccgctcgaggccgctgccaaggcc
aagaacctcaactacgtcaagctcgacggcgaggtcggcatcatcggtaacggtgccggt
ctggtcatgtcgaccctggacgtcgtcgcgtacgccggtgagaagcacggcgacgtgaag
cccgccaacttcctcgacatcggtggcggcgcctccgccgaggtcatggcgaacggcctg
gagatcattctcggggacccggacgtccggtccgtcttcgtcaacgtcttcggtggcatc
accgcctgcgacgaggtcgccaacggcatcgtccaggctctggagctgctcaagaccaag
ggcgaggacgtcaccaagccgctggtcgtgcgcctcgacggcaacaacgcggaactgggt
cgcaagatcctctccgacgccaaccacccgctcgtgcagcgcgtggacaccatggacggc
gcggccgacaaggccgccgagctcgccgcggctgcgaagtaa

DBGET integrated database retrieval system