KEGG   Streptomyces sp. SirexAA-E: SACTE_4088Help
Entry
SACTE_4088        CDS       T01601                                 

Definition
ornithine aminotransferase
Orthology
K00819  
ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ssx00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4528733..4529938)
Genome map
AA seq 401 aa AA seqDB search
MSTTENALASAEAHSAHTYHPLPVVVATADGAWMTDVEGRRYLDLLAGYSALNFGHGNRR
LLDAARAQLERVTLTSRAFQHDRFADFCTQLAELCGMEMVLPMNTGAEAVETAVKTARKW
GYRVKGVPDGMAKIVVAADNFHGRTTTVISFSTDPEARADYGPYTPGFEIVPYGDLTALA
DAMTENTVAVLLEPIQGEAGVLVPPSGYLAGVRELTRERNVLFVADEIQSGLGRTGRTFA
LEHEGVVPDMYLLGKALGGGVVPVSAVVSSAAVLGVFRPGEHGSTFGGNPLACAVALEVI
AMLRTGEYQERAAELGDHLHRELGLLAGGDAVTAVRGRGLWAGVDIDPGLGTGREISEKL
MDRGVLVKDTHGSTIRIAPPLVIGKEDLDWGLDQLRAVLGG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccacggagaacgccctcgcctccgccgaggcgcacagcgcgcacacctaccac
ccgttgccggtcgtcgtggcgaccgcggacggtgcctggatgaccgacgtggagggccgg
cggtacctcgacctgctggccggttactcggcgctcaacttcggccacggcaaccgacgt
ctgctcgacgcggcccgtgcccagctggagcgggtgaccctgacctcgcgcgccttccag
cacgaccggttcgccgacttctgtacgcagttggccgagctgtgcggcatggagatggtg
ctgcccatgaacaccggggcggaggcagtggagacggcggtgaagaccgcccgcaagtgg
ggctaccgcgtcaagggcgtcccggacggcatggcgaagatcgtcgtggccgccgacaac
ttccacggccgcacgaccaccgtcatcagcttctccacggacccggaggcgcgtgccgac
tacggcccgtacaccccggggttcgagatcgtgccgtacggggacctgaccgcgctcgcc
gacgcgatgaccgagaacacggtcgccgtgctgctggagcccatccagggggaggccggg
gtcctggtgccgccgtccggctacctggccggggtgcgggagctgacccgggagcggaac
gtgctcttcgtcgcggacgagatccagtcggggctcgggcgcaccggccggaccttcgcc
ctggaacacgagggagtcgtccccgacatgtacctcctggggaaggcgctgggcggcggt
gtcgtgccggtgtcggccgtcgtctcgtcggccgccgtgctcggggtcttccgccccggt
gagcacgggtcgacgttcggcggcaatccgctggcctgcgcggtcgcgctggaggtgatc
gcgatgctgcgcaccggggagtaccaggagcgggcggcggagctgggcgaccatctgcac
cgcgagctggggctgctggccggcggcgacgcggtgacggcggtccgggggcgcggactg
tgggcgggggtcgacatcgacccggggctcgggacgggccgggagatctcggagaagctg
atggaccgcggggtcctggtcaaggacacccacggctccaccatccggatcgccccgccg
ctggtcatcggcaaggaggacctggactggggcctggaccagctccgcgccgtcctgggc
ggctga

DBGET integrated database retrieval system