KEGG   Streptomyces sp. SirexAA-E: SACTE_4088Help
Entry
SACTE_4088        CDS       T01601                                 

Definition
ornithine aminotransferase
Orthology
K00819  
ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SACTE_4088
Enzymes [BR:ssx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     SACTE_4088
Amino acid related enzymes [BR:ssx01007]
 Aminotransferase (transaminase)
  Class III
   SACTE_4088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4528733..4529938)
Genome map
AA seq 401 aa AA seqDB search
MSTTENALASAEAHSAHTYHPLPVVVATADGAWMTDVEGRRYLDLLAGYSALNFGHGNRR
LLDAARAQLERVTLTSRAFQHDRFADFCTQLAELCGMEMVLPMNTGAEAVETAVKTARKW
GYRVKGVPDGMAKIVVAADNFHGRTTTVISFSTDPEARADYGPYTPGFEIVPYGDLTALA
DAMTENTVAVLLEPIQGEAGVLVPPSGYLAGVRELTRERNVLFVADEIQSGLGRTGRTFA
LEHEGVVPDMYLLGKALGGGVVPVSAVVSSAAVLGVFRPGEHGSTFGGNPLACAVALEVI
AMLRTGEYQERAAELGDHLHRELGLLAGGDAVTAVRGRGLWAGVDIDPGLGTGREISEKL
MDRGVLVKDTHGSTIRIAPPLVIGKEDLDWGLDQLRAVLGG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccacggagaacgccctcgcctccgccgaggcgcacagcgcgcacacctaccac
ccgttgccggtcgtcgtggcgaccgcggacggtgcctggatgaccgacgtggagggccgg
cggtacctcgacctgctggccggttactcggcgctcaacttcggccacggcaaccgacgt
ctgctcgacgcggcccgtgcccagctggagcgggtgaccctgacctcgcgcgccttccag
cacgaccggttcgccgacttctgtacgcagttggccgagctgtgcggcatggagatggtg
ctgcccatgaacaccggggcggaggcagtggagacggcggtgaagaccgcccgcaagtgg
ggctaccgcgtcaagggcgtcccggacggcatggcgaagatcgtcgtggccgccgacaac
ttccacggccgcacgaccaccgtcatcagcttctccacggacccggaggcgcgtgccgac
tacggcccgtacaccccggggttcgagatcgtgccgtacggggacctgaccgcgctcgcc
gacgcgatgaccgagaacacggtcgccgtgctgctggagcccatccagggggaggccggg
gtcctggtgccgccgtccggctacctggccggggtgcgggagctgacccgggagcggaac
gtgctcttcgtcgcggacgagatccagtcggggctcgggcgcaccggccggaccttcgcc
ctggaacacgagggagtcgtccccgacatgtacctcctggggaaggcgctgggcggcggt
gtcgtgccggtgtcggccgtcgtctcgtcggccgccgtgctcggggtcttccgccccggt
gagcacgggtcgacgttcggcggcaatccgctggcctgcgcggtcgcgctggaggtgatc
gcgatgctgcgcaccggggagtaccaggagcgggcggcggagctgggcgaccatctgcac
cgcgagctggggctgctggccggcggcgacgcggtgacggcggtccgggggcgcggactg
tgggcgggggtcgacatcgacccggggctcgggacgggccgggagatctcggagaagctg
atggaccgcggggtcctggtcaaggacacccacggctccaccatccggatcgccccgccg
ctggtcatcggcaaggaggacctggactggggcctggaccagctccgcgccgtcctgggc
ggctga

DBGET integrated database retrieval system