KEGG   Streptomyces sp. SirexAA-E: SACTE_4106Help
Entry
SACTE_4106        CDS       T01601                                 

Definition
glycoside hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssx00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ssx00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4546993..4548606
Genome map
AA seq 537 aa AA seqDB search
MSPSHRATPRSRGALVAGAAVTAAAAVTLTVVLWPDSSGSGPQNGAASSPTTPSPSPTRS
YPLSETPRTVPAVRAHTPARGPGWKPGKNSTVVAADHELADEAQLLAKELKIRYRGETAA
RAGDVELALGTAGKGDAESYTLKTADDRVTISGPGEAGVFYGTRTLLQSLAADSSVPEGV
VRDTPDRPQRGLNLDIARKHYSADWIEDRLREMADLKLNQLGLHFSDDQAFRIESESHPE
VVSEEHLTKAEVRRILKLAQSLHITVVAEIDSPGHLGAVLKAHPDLQLRNTQGTARQGAI
DISKPEAAEIVDDLLREYAELFPGQWFHVGADEYQALTVSDPASSYPQLATAAREKYGDG
ATVQDLTEGWLNDRAAVVRKAEKIPKAWNDGFFSGGTVTAEKGVEVEYWTGKEIGARPPQ
DYLAEGRKVVNLNDEFLYYVLGEPNDFVYPTGKRIYEQWTPLVLRGTEPVPERYSKQILG
GRFAVWGDFPDAQTQAQVAEGIRMPLNALSQKLWDPRKPSLSWAQFQKLADEVAGKS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctcgcaccgagccacgccacgctcgcgcggagccctggtggccggcgcggcc
gtcacggcagcagccgccgtcaccctcaccgtcgtcctctggcccgacagctccggctcc
ggaccgcagaacggcgccgcctcctcgcccaccacgccctcgccgtcccccacgcgcagc
tacccgctctccgagacgccgcggaccgtacccgcggtccgcgcgcacacccccgcccgc
gggcccggctggaaacccgggaagaacagcacggtcgtcgccgccgaccacgagctggcc
gacgaggcgcagctgctcgccaaggagctgaagatccgctaccgcggggagaccgcggcc
cgggccggtgacgtggagctggcgctcggcaccgccggcaagggcgacgcggagtcgtac
acgctgaagacggccgacgaccgggtcaccatcagcgggcccggcgaggccggcgtcttc
tacggcacccgcacgctcctgcagtcgctcgccgccgacagctccgtccccgagggcgtg
gtccgcgacacccccgaccggccgcagcgcggactcaacctcgacatcgcgcgcaagcac
tacagcgccgactggatcgaggaccggctccgcgagatggccgacctcaagctcaaccag
ctcggcctgcacttctccgacgaccaggccttccgcatcgagtccgagtcgcacccggag
gtggtctccgaggagcacctgaccaaggccgaggtccgccggatactgaagctcgcccag
agcctccacatcaccgtcgtcgccgagatcgattcacccggacacctgggagcggtcctc
aaggcccaccccgacctgcaactgcgcaacacccagggcacggcccgccagggagccatc
gacatctccaagcccgaggcggccgagatcgtcgacgacctgctgcgtgagtacgccgag
ctgttccccggccagtggttccacgtcggcgccgacgagtaccaggcgctcaccgtcagc
gacccggcgtcctcctacccgcagctcgccacggccgcccgcgagaagtacggcgacggc
gccaccgtccaggacctgaccgagggctggctgaacgaccgggcggccgtcgtgcggaag
gcggagaagatccccaaggcgtggaacgacggcttcttcagcggcggcacggtcaccgcg
gagaagggcgtcgaggtcgagtactggaccggcaaggagatcggcgcacggccgccccag
gactacctcgccgagggccgcaaggtggtcaacctcaacgacgagttcctctactacgtg
ctcggcgagcccaacgacttcgtctacccgacgggcaagcggatctacgagcagtggacc
ccgctggtgctgcgcggcaccgagccggtgcccgagcgctactcgaagcagatcctgggc
ggccggttcgcggtatggggcgacttccccgacgcgcagacccaggcgcaggtggccgag
ggcatccggatgccgctcaacgccctttcccagaagctgtgggacccgcgcaaaccgtcg
ctgagctgggcgcagttccagaagctcgccgacgaggtcgccgggaagagctga

DBGET integrated database retrieval system