KEGG   Streptomyces sp. SirexAA-E: SACTE_4115Help
Entry
SACTE_4115        CDS       T01601                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00360  Phenylalanine metabolism
ssx00362  Benzoate degradation
ssx00620  Pyruvate metabolism
ssx00621  Dioxin degradation
ssx00622  Xylene degradation
ssx00650  Butanoate metabolism
ssx01100  Metabolic pathways
ssx01120  Microbial metabolism in diverse environments
ssx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SACTE_4115
   00650 Butanoate metabolism
    SACTE_4115
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SACTE_4115
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACTE_4115
   00622 Xylene degradation
    SACTE_4115
   00621 Dioxin degradation
    SACTE_4115
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SACTE_4115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh DapB_N
Motif
Other DBs
NCBI-ProteinID: AEN11955
UniProt: G2NIQ9
Position
complement(4555339..4556295)
Genome map
AA seq 318 aa AA seqDB search
MSTPATDAVPVAVIGSGNIGTDLMIKVMRLSKTLRMGAMVGIDPASDGLARAGRLGVATT
HQGVEGLVGMPGFADIKVIFDATSAKAHGRNAEIARQHGKLMVDLTPAALGPFVVPSVNL
DDHLDAPDVNMVTCGGQATIPVVAAVSRIAPVAYGEIVASISSRSAGPGTRANIDEFTET
TGEAIRVVGGASVGKAIIVLNPAEPPIVMRDTVYCLVEGAVDAGTRERIVASVRQMAETV
QEYVPGYRLKQDVQFDAVEDAVVPALGRRVTGVRVSVFLEVLGAGHYLPDYAGNLDIMTS
AAVRTAEKITALRGRVDA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacaccggccacggacgcggttccggtcgccgtcatcgggtccggcaacatcggg
accgacctcatgatcaaggtcatgcggctgtcgaagacgctccgcatgggcgccatggtg
ggcatcgacccggcctccgacgggctcgcccgtgccgggcggctgggggtggccaccacc
caccagggcgtcgagggtctcgtcgggatgcccgggttcgcggacatcaaggtgatcttc
gacgccacctccgccaaggcgcacgggcgcaacgcggagatcgcccgtcagcacgggaag
ctgatggtcgacctgacgccggcggccctcggtccgttcgtggtgccgtcggtcaatctg
gacgaccacctggacgcgccggacgtcaacatggtgacctgcggaggccaggcgaccatc
cccgtcgtcgccgcggtctcccggatcgccccggtcgcgtacggcgagatcgtcgcgtcc
atctcctccaggtcggccgggccggggacccgggccaacatcgacgagttcaccgagacg
accggcgaggccatccgcgtcgtcggcggcgcctcggtgggcaaggcgatcatcgtgctc
aacccggccgaaccgcccatcgtcatgcgcgacaccgtgtactgcctcgtcgagggggcg
gtggacgccggtacgcgggaacggatcgtcgcctccgtacggcagatggccgaaaccgtc
caggagtacgtgccgggctaccggctcaagcaggacgtgcagttcgacgcggtcgaggac
gccgtggtcccggctctcggccggcgggtcaccggggtcagggtctcggtgttcctggag
gtgctgggcgcgggccactacctgcccgactacgccgggaacctcgacatcatgacctcc
gccgcggtccggaccgccgagaagatcaccgcactccgaggacgggtggacgcatga

DBGET integrated database retrieval system