KEGG   Streptomyces sp. SirexAA-E: SACTE_4150Help
Entry
SACTE_4150        CDS       T01601                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ssx00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4597640..4598917
Genome map
AA seq 425 aa AA seqDB search
MDAISVIRTKRDRGELSPEQIDWVIDAYTRGEVADEQMSALAMAILLNGMNRTEIARWTA
AMIASGERMSFGALSRPTTDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRALLSNAEMLDVLDTTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGALVLDVKVGSGAFMKTIEDARELASTMVALGTDSGVRTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPQDVIDLTLALAREMLDAAGLKDADPEKALADGSAM
DVWRRMISAQGGDPDAALPVAREQHVITAPSSGVLTRLDAYDIGVAAWRLGAGRARKEDP
VQAGAGVELHAKPGDTVTEGQPLLTLHTDTPEKFAYALETLPGSYDIAPAGTPFTATPVV
RERIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgcaccaagcgggaccgaggcgaactcagccccgagcag
atcgactgggtgatcgacgcctacacccgcggcgaggtcgccgacgagcagatgtccgcg
ctggccatggcgatcctgctgaacggcatgaaccgcaccgagatcgcccgctggaccgcc
gcgatgatcgcctccggcgagcggatgagcttcggcgcgctgtcccgtcccacgaccgac
aagcactccaccggcggcgtcggcgacaagatcacgctgccgctcgccccgctggtcgcc
gcctgcggtgccgccgtcccgcagctcagcggccggggcctcggccacaccggcggcacc
ctggacaagctggagtcgatccccggctggcgcgcgctcctgtccaacgccgagatgctg
gacgtcctggacaccaccggcgccgtcatctgcgcggccggcgacgggctcgcccccgcc
gacaagaagctctacgcgctccgcgacgtcaccgggaccgtcgaggcgatcccgctcatc
gccagctcgatcatgtccaagaagatcgccgagggcaccggggcgctcgtcctggacgtc
aaggtcggctccggcgccttcatgaagaccatcgaggacgcccgcgaactggcctccacc
atggtcgcgctcggcaccgacagcggtgtccggacggtcgcgctgctcaccgacatgtcg
accccgctcggcctgaccgcgggcaacgccctggaggtacgcgagtccgtcgaggtcctc
gccggcggcggcccgcaggacgtgatcgacctgaccctggcgctcgcccgcgagatgctg
gacgccgccgggctcaaggacgccgacccggagaaggccctcgccgacggctccgccatg
gacgtgtggcgccgcatgatctccgcccagggcggcgacccggacgccgcgctccccgtg
gcccgcgagcagcacgtgatcaccgccccctcctccggggtgctgacccgcctggacgcc
tacgacatcggcgtcgccgcctggcgcctcggcgccggccgggcccgcaaggaggacccg
gtgcaggcgggcgcgggcgtcgagctgcacgcgaagccgggcgacaccgtgaccgagggc
cagccgctgctgaccctgcacacggacacccccgagaagttcgcgtacgccctggagacc
ctgcccggctcgtacgacatcgcccccgccggcacgcccttcaccgccacgccagtggtg
cgggaacgtatcgcctga

DBGET integrated database retrieval system