KEGG   Streptomyces sp. SirexAA-E: SACTE_4305Help
Entry
SACTE_4305        CDS       T01601                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ssx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssx00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssx00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4752580..4753302
Genome map
AA seq 240 aa AA seqDB search
MDIGGSGIKGAPVDLDRGELAQERHKVLTPRPATPDGVADGVAEVVGHFDWKGPVGITFP
GVVTGGITRTAANVDKAWIDTDARALLSDRIGHPVTILNDADAAGVAEMTFGAGRGRKGT
VIVLTLGTGIGSAVFTDGQLVPNTELGHLELHGHDAEKRASTKAKEDEDLSWSHWAHRVQ
KYLVHVEMLFSPSLFIIGGGVSRKAEKFLPLIEHVRAEMVPAELQNNAGIVGAAMAAAGN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcggcgggtcagggatcaagggcgctcccgtggacctggaccgcggagagctg
gcgcaggagcgccacaaggtactgacaccgcgtccggccacgcccgacggcgtggccgac
ggcgtggccgaggtcgtcggccacttcgactggaagggcccggtgggcatcaccttcccc
ggagtggtcaccggggggatcacccggaccgcggccaacgtcgacaaggcgtggattgac
acggacgcccgcgcgctgctcagcgaccgcatcgggcacccggtcacgatcctcaacgac
gccgacgcggccggtgtcgccgagatgaccttcggcgcgggacgcggccgcaagggcacg
gtgatcgtgctgaccctcggtacgggcatcggcagcgccgtcttcacggacgggcagctc
gtccccaacaccgagctcggccacctggaactgcacgggcacgacgcggagaagcgggcg
tccacgaaggccaaggaggacgaggacctcagctggagccactgggcgcaccgggtgcag
aagtacctcgtccacgtcgagatgctcttctcgccctcgctgttcatcatcggcggggga
gtcagccgcaaggcggagaagttcctgccgctcatcgaacacgtacgggccgagatggtc
ccggccgagctgcagaacaacgcgggcatcgtcggcgccgccatggcggcggccggcaac
tga

DBGET integrated database retrieval system