KEGG   Streptomyces sp. SirexAA-E: SACTE_4305Help
Entry
SACTE_4305        CDS       T01601                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00520  Amino sugar and nucleotide sugar metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
Module
ssx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_4305
   00520 Amino sugar and nucleotide sugar metabolism
    SACTE_4305
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SACTE_4305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEN12140
UniProt: G2NFE2
Position
4752580..4753302
Genome map
AA seq 240 aa AA seqDB search
MDIGGSGIKGAPVDLDRGELAQERHKVLTPRPATPDGVADGVAEVVGHFDWKGPVGITFP
GVVTGGITRTAANVDKAWIDTDARALLSDRIGHPVTILNDADAAGVAEMTFGAGRGRKGT
VIVLTLGTGIGSAVFTDGQLVPNTELGHLELHGHDAEKRASTKAKEDEDLSWSHWAHRVQ
KYLVHVEMLFSPSLFIIGGGVSRKAEKFLPLIEHVRAEMVPAELQNNAGIVGAAMAAAGN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcggcgggtcagggatcaagggcgctcccgtggacctggaccgcggagagctg
gcgcaggagcgccacaaggtactgacaccgcgtccggccacgcccgacggcgtggccgac
ggcgtggccgaggtcgtcggccacttcgactggaagggcccggtgggcatcaccttcccc
ggagtggtcaccggggggatcacccggaccgcggccaacgtcgacaaggcgtggattgac
acggacgcccgcgcgctgctcagcgaccgcatcgggcacccggtcacgatcctcaacgac
gccgacgcggccggtgtcgccgagatgaccttcggcgcgggacgcggccgcaagggcacg
gtgatcgtgctgaccctcggtacgggcatcggcagcgccgtcttcacggacgggcagctc
gtccccaacaccgagctcggccacctggaactgcacgggcacgacgcggagaagcgggcg
tccacgaaggccaaggaggacgaggacctcagctggagccactgggcgcaccgggtgcag
aagtacctcgtccacgtcgagatgctcttctcgccctcgctgttcatcatcggcggggga
gtcagccgcaaggcggagaagttcctgccgctcatcgaacacgtacgggccgagatggtc
ccggccgagctgcagaacaacgcgggcatcgtcggcgccgccatggcggcggccggcaac
tga

DBGET integrated database retrieval system