KEGG   Streptomyces sp. SirexAA-E: SACTE_4471Help
Entry
SACTE_4471        CDS       T01601                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssx00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ssx00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4944043..4945566
Genome map
AA seq 507 aa AA seqDB search
MTTLVSTTDTVTRDALAVLQPGFTGTTAPDWLLRRVGEGLASVGLFGRNIHSPEQLAALT
ARLRAERDDVLVAIDEEGGDVTRLEVRDGSSFPGNLALGSVDDVELTRAVAQELGRRLAE
CGVNLNWAPSADVNSNPGNPVIGVRSFGADPDLVARHTAAYVQGLQASGVAACTKHFPGH
GDTAVDSHLALPSIEVDLETLHARELVPFRAAIAAGSKSVMSAHILLPALDAARPATLSP
QILTGLLRQELGYEGLIVTDGMEMDAIAGTYGIERGSVLAIAAGADAICVGGGLADEDTV
LLLRDALVAAVRSGDLPEERLADAAARVRALASWTQRARGAGSEPGAAVQEGTAPGTGVS
SDIGLAAARRALRSTGTAAPQTEPVYVAAFTPVANIAVGAETPWGVAAELERLLPGTATG
TYGGAEVEAVLRAAGERRVVAVVRDEHRHPWMGEALDGLLAARPDTVVVEMGLPEAPARG
ALHIATYGAARVCGAAAAEAITGARTA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcgtatccaccacggacaccgtcacgcgcgacgcgctcgccgtgctccag
cccggattcaccgggaccaccgcaccggactggctgctgcgcagggtcggcgaaggcctg
gcctccgtcgggctgttcggccgcaacatccactcgcccgaacagctcgccgcgctcacc
gcccggctgcgggccgagcgcgacgacgtgctcgtcgcgatcgacgaggagggcggggac
gtcacccgcctggaggtccgggacggctcgtccttccccggcaacctggccctcggatcc
gtcgacgacgtcgagctgacccgggccgttgcccaggagctcggccgccggctggccgag
tgcggggtgaacctcaactgggcgccgtccgccgacgtcaactccaacccgggcaacccg
gtcatcggcgtacggtccttcggcgccgacccggacctcgtcgcccgccacacggccgcg
tacgtccaggggctgcaggcctccggcgtcgccgcctgcaccaagcacttccccggccac
ggcgacaccgcggtcgactcgcacctcgcgctcccgagcatcgaggtggacctggagacc
ctgcacgcccgtgagctggtgcccttccgggcggcgatcgcggcgggttccaaatcggtg
atgagcgcgcatatcctgcttcccgcgctcgacgccgcccggcccgcgacgctcagcccg
cagatcctcaccggcctgctgcgtcaggagctggggtacgaggggctcatcgtcaccgac
ggcatggagatggacgccatcgccggcacgtacggcatcgagcgcggctccgtcctcgcc
atcgccgcgggtgccgacgccatctgcgtgggcggcggactcgcggacgaggacaccgtg
ctgctgctgcgcgacgcgctcgtcgcggcggtgcggagcggtgaccttcccgaggagcgg
ctggccgacgccgccgcccgggtacgggccctcgcgtcctggacgcagcgggccaggggg
gctggttcggagccgggcgcggcagtgcaggaggggaccgcgcccggcaccggagtcagc
tcggacatcggcctcgccgcggcccgccgagccctgcggtcgaccggcaccgccgcgccg
cagaccgagccggtgtacgtcgccgcgttcaccccggtcgcgaacatcgcggtcggcgcc
gagaccccgtggggcgtcgccgccgagctggaacggctgctgcccggcaccgcgaccggg
acgtacggcggtgccgaggtggaggcggtgctgcgggcggcgggggagcggcgcgtcgtc
gcggtcgtccgtgacgaacaccggcacccgtggatgggcgaggcgctggacggcctgctg
gcggcccgccccgacaccgtcgtggtcgagatgggactgcccgaggcgccggcccgtgga
gccctgcacatcgccacctacggcgccgcccgggtctgcggggccgcggccgcggaggcg
atcaccggggcacgcacggcgtag

DBGET integrated database retrieval system