KEGG   Streptomyces sp. SirexAA-E: SACTE_4730Help
Entry
SACTE_4730        CDS       T01601                                 

Definition
Ricin B lectin
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SACTE_4730
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SACTE_4730
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SACTE_4730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5238426..5240294)
Genome map
AA seq 622 aa AA seqDB search
MMRTSRAARVLVATALATAGLAGLSSGTAQAAGETVNIVLTTTDDSGGRHVTRGLQAQTP
TSFGAGNGGSGTNITVDENTRYQTFTGGGASFTDTAAWLMKGSGALSQATRDETMRKLFS
PTEGIGLSFVRNPMGGSDLARFGYTYDDLPAGQTDPGLTKFSIAHDLQDVLPLTKQAKQL
NPALTTVASPWTAPAWMKDSGRLDGGWLKAENYGTYADYFVKYLQAWRDQGVPVDYVTAQ
NEPTCCSGYPSMSWNGSGLAYFTKSELLPGLRSAGLPTKVLAHDWNWDSYDAYAAPTVDD
AAVRDHPNFGGIAWHGYGGDIAKQTSVHNQYPQLDAFQTEHSGGTWIADQQREDMLNIID
YTRNWAKSVTKWSLAVDQNRGPHNGGCGTCDGLVTVHNGDGRHGQVDYTIEYYTMGHLTK
YVRPGASRIASTASSTVPNVAWRNPDGSKALIAYNGSGSTQQVTVNWGGQRFTYSLPGRT
SATFTWSGTQSGSPATGGALTGIGDKCLDATDNSSADGTPVQIWDCTGAANQRWTVGGDG
SVTVLGACLDVTSGSTADGAKVQLYTCNGSGAQRWTYNASTGDVVNTAANKCLDVVDRSS
ANGARLQIWTCTGAANQKWRLR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggacaagcagagcggcgagagtcctcgtcgcgacggcactcgcgaccgcggga
ctggccgggctctcctccggcaccgcccaggccgcaggcgagaccgtgaacatcgtgctg
accaccacggacgactccggcggccggcacgtcacccggggcctccaggcgcagacgccg
acctccttcggtgccggcaacggcggctccggcacgaacatcaccgtcgacgagaacacc
cgctaccagacgttcaccggcggcggtgcctcgttcacggacaccgccgcgtggctgatg
aagggcagcggcgcgctcagccaggccacccgcgacgagacgatgaggaagctgttctcc
cccacggagggcatcggactctccttcgtacgcaatccgatgggcggttcggacctggcg
cgcttcggctacacctacgacgacctgccggccggtcagaccgacccgggcctcacgaag
ttctcgatcgcacacgacctccaggacgtcctgccgctcaccaagcaggccaagcagctc
aacccggccctcaccaccgtcgcctccccgtggacggctccggcctggatgaaggacagc
ggccgactcgacggcggctggctgaaggccgagaactacggcacctacgcggactacttc
gtgaagtacctccaggcgtggcgcgaccagggcgtcccggtcgactacgtcaccgcgcag
aacgagcccacctgctgctccggctacccctcgatgagctggaacggctcgggactggcc
tacttcaccaagagcgagctgctgccggggctccggtcggcgggcctgcccaccaaggtc
ctggcgcacgactggaactgggacagctacgacgcgtacgccgctcccacggtggacgac
gcggcggtgcgcgaccacccgaacttcggcgggatcgcctggcacggctacggcggggac
atcgccaagcagacgtccgtgcacaaccagtacccgcagctggacgccttccagacggag
cactcgggcggcacctggatcgccgaccagcagcgcgaggacatgctcaacatcatcgac
tacacccgcaactgggcgaagtcggtgaccaagtggtccctggccgtggaccagaaccgc
ggtccgcacaacgggggttgcggcacctgcgacgggctggtcaccgtgcacaacggggac
ggccggcacggtcaggtcgactacacgatcgagtactacacgatgggccacctgacgaag
tacgtccggccgggcgcctcccgtatcgcctccaccgccagctccacggtgcccaacgtc
gcctggcggaacccggacggctccaaggccctgatcgcgtacaacggttcgggctccacc
cagcaggtgacggtgaactggggcggccagaggttcacctactcgctgcccggccggacc
tcggcgaccttcacgtggtcgggcacccagtccggctcgccggccaccggcggcgccctc
accggcatcggcgacaagtgcctggacgccacggacaacagctcggccgacggcaccccg
gtccagatctgggactgcaccggagcggccaaccagcgctggacggtcggcggcgacgga
tcggtcaccgtgctgggcgcctgcctggacgtgacctcgggctcgacggccgacggtgca
aaggtccagctgtacacctgcaacggttccggggcgcagcgctggacgtacaacgcctcc
accggggacgtggtgaacacggccgcgaacaagtgcctggacgtcgtggaccgctcctcg
gcgaacggcgcccggctccagatctggacgtgcaccggagccgccaaccagaagtggcgg
ctccggtag

DBGET integrated database retrieval system