KEGG   Streptomyces sp. SirexAA-E: SACTE_5367Help
Entry
SACTE_5367        CDS       T01601                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00052  Galactose metabolism
ssx00500  Starch and sucrose metabolism
ssx00520  Amino sugar and nucleotide sugar metabolism
ssx00521  Streptomycin biosynthesis
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
Module
ssx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_5367
   00052 Galactose metabolism
    SACTE_5367
   00500 Starch and sucrose metabolism
    SACTE_5367
   00520 Amino sugar and nucleotide sugar metabolism
    SACTE_5367
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SACTE_5367
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SACTE_5367
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SACTE_5367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEN13176
UniProt: G2NPY7
Position
complement(6067283..6068227)
Genome map
AA seq 314 aa AA seqDB search
MSTAATGAVVIGLDLGGTKIAAALFAADGTVLSRHTRPTPARDGAEAVLDALAAAAAAVD
PGRLATALGIAAAGVVDPRSGMVTSATDSISGWAGTALGTGLADRTGLPVACDNDVRATA
GPELAALPDGHGSLLFAAVGTGVGGALAVDGRMLHGAAGIAGHLGHLPSAEAAGLPCTCG
ATGHLEVIASGPGIAAHYERLTGTPVDRLETVAARAAEGERAAVRAVTTGATAAGRVLGG
LANALGPDRVVVAGGVPRIGALYREALAAAFAAELMPPLRGLVPEPPLFGHDAAVLGAAA
LTTALPLHHPGALR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcggcgaccggggccgtggtgatcggcctcgacctcggcgggacgaagatc
gcggccgcgctcttcgccgccgacggcacggtgctgtcccggcacacccggcccaccccg
gcccgggacggcgccgaggcggtgctcgacgcactcgcggcggcggccgccgcggtggac
ccgggccggctggccacggcgctcggcatcgccgccgccggggtcgtcgacccccgcagc
ggcatggtcaccagcgccaccgactcgatcagcggctgggcgggcaccgcgctcggcacc
ggccttgcggaccgcacgggcctgcctgtggcctgcgacaacgacgtacgcgccacggcc
ggaccggagctcgccgcactgccggacggccacggctcgctgctgttcgcggccgtcggc
acgggcgtgggcggtgcgctcgccgtcgacgggcggatgctgcacggcgcggccggtatc
gccggccacctcggccatctgcccagcgcggaggcggccggactgccctgcacctgcggg
gccaccggtcacctggaggtcatcgcctccgggccgggcatcgccgcccactacgagcgg
ctcaccggcacccccgtggaccggctcgaaacggtcgccgcccgtgccgccgagggcgag
cgggccgccgtgcgggccgtcaccaccggtgcgaccgcggccggacgggtcctcggcggc
ctcgccaacgcgctcggccccgaccgggtcgtcgtcgccggcggggtgccgcggatcggc
gcgctctaccgcgaggccctggccgccgccttcgcggccgagctgatgccgccgctgcgc
gggctcgtccccgagcctccgctcttcggccacgacgccgccgtgctgggcgccgcggcc
ctgaccaccgcccttcccctccaccacccgggagctctccgatga

DBGET integrated database retrieval system