KEGG   Streptomyces sp. SirexAA-E: SACTE_5472Help
Entry
SACTE_5472        CDS       T01601                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ssx01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ssx00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ssx00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6185030..6186649)
Genome map
AA seq 539 aa AA seqDB search
MSAPAPSPLAIVDAEPLPRQDEVLTDAALAFVAELHRRFTPRRDELLARRAERRAEIART
STLDFLPETQAIRVDDTWKVAPAPAALDDRRVEITGPTDRKMTVNALNSGAKVWLADFED
ASAPTWENVVTGQLNLIDAYTRNIDFTDPRSGKSYALRPAEELATVVTRPRGWHLDERHL
QQDGTPVPGALVDFGLYFFHNAQRLIDLGKGPYFYLPKTESHLEARLWNDIFVFAQDYVG
IPRGTVRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGPKFVLP
DRNLVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDAEVNKVAFEKVKADKDR
EANDGFDGSWVAHPDLVPIAMESFDAVLGDKPNQKDRLREDVSVAAGDLIAVDTLDARPS
YDGLRNAVAVGIRYIEAWLRGMGAVAIFNLMEDAATAEISRSQIWQWINADVVFENGEHA
TADLARTIAAEELATIRAEVGHEAFAAGKWQQAHDLLLTVSLDEDYADFLTLPAYEQLR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccccgctggccatcgtcgatgccgagcccctgccgaggcag
gacgaggtcctgaccgatgcggccctcgcgttcgtggccgagctgcaccggcggttcaca
ccccggcgtgacgagctgctcgcccgccgggccgagcgccgcgccgagatcgcgcgcacc
tccacgctggacttcctgcccgagacgcaggcgatccgggtggacgacacctggaaggtc
gccccggccccggccgcgctggacgaccgccgggtggagatcaccggtccgaccgaccgg
aagatgaccgtcaacgcgctgaactccggcgccaaggtctggctcgccgacttcgaggac
gcgtccgccccgacgtgggagaacgtggtcaccggccagctgaacctgatcgacgcctac
acccggaacatcgacttcaccgacccgaggtccggcaagtcctacgcgctcaggcccgcc
gaggagctcgcgaccgtcgtcacccgcccgcgcggctggcacctggacgagcgccacctc
cagcaggacggcaccccggtgcccggcgccctggtcgacttcggcctctacttcttccac
aacgcccagcggctgatcgacctcggcaagggcccgtacttctacctcccgaagacggag
tcgcacctggaggcgcgcctctggaacgacatcttcgtcttcgcccaggactacgtcggc
atcccgcggggcacggtccgggcgaccgtcctgatcgagacgatcaccgccgcgtacgag
atggaggagatcctctacgagctgcgcgaccacgcctcggggctgaacgcgggccgctgg
gactacctcttctccatcgtcaagaacttccgtgacggcggcccgaagttcgtcctgccg
gaccgcaacctggtgacgatgacggccccgttcatgcgggcgtacaccgaactcctggtc
cgtacctgccacaagcgcggggcgcacgccatcgggggcatggccgccttcatcccctcg
cggcgcgacgccgaggtcaacaaggtcgccttcgagaaggtcaaggccgacaaggaccgc
gaggcgaacgacggcttcgacggctcatgggtggcccacccggacctggtcccgatcgcg
atggagtccttcgacgcggtcctcggcgacaagccgaaccagaaggaccgcctgcgcgag
gacgtctcggtggcggccggcgacctgatcgccgtcgacaccctggacgccaggccctcg
tacgacggcctgcgcaacgccgtcgccgtcggcatccgctacatcgaggcgtggctgcgg
ggcatgggcgcggtcgccatcttcaacctgatggaggacgcggccaccgcggagatctcc
cgctcgcagatctggcagtggatcaacgcggacgtggtcttcgagaacggcgaacacgcc
acggccgacctggcccgcacgatcgcggccgaggaactggccacgatccgcgcggaggtc
ggccacgaggccttcgccgccgggaagtggcagcaggcccacgacctgctgctcacggtc
tcgctggacgaggactacgcggacttcctgacattgccggcgtacgagcagctgcgctga

DBGET integrated database retrieval system