KEGG   Streptomyces sp. SirexAA-E: SACTE_5496Help
Entry
SACTE_5496        CDS       T01601                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00052  Galactose metabolism
ssx00500  Starch and sucrose metabolism
ssx00520  Amino sugar and nucleotide sugar metabolism
ssx00521  Streptomycin biosynthesis
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
Module
ssx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_5496
   00052 Galactose metabolism
    SACTE_5496
   00500 Starch and sucrose metabolism
    SACTE_5496
   00520 Amino sugar and nucleotide sugar metabolism
    SACTE_5496
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SACTE_5496
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SACTE_5496
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SACTE_5496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AEN13305
UniProt: G2NG59
Position
6207703..6208872
Genome map
AA seq 389 aa AA seqDB search
MSTYRDFTHRGSARATVLRTVGTRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADGNILE
TLRTETPDKSKSPKVVEDTIVELVLDLSDRHDVHAVGIGAAGWVDADRSKVLFAPHLAWR
DEPLRDALASRLVVPVMVDNDANTAAWAEWRFGAGRGEDHLVMITLGTGIGGAILEDGHV
KRGKYGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREAKELAAADSPVAHGIIE
RVKGNIPDITGPLITELAREGDAMCVELLQDIGQWLGVGIANLAAALDPSCFVIGGGVSA
ADDLLIGPARDAFKRQLTGRGYRPEARIAKAQLGPEAGMVGAADLARLVARRFRRTNRRR
VERYERYAQIYDQAASTLRSTRNGTRDAG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtaccgcgacttcacccaccgcggctccgcccgcgccaccgtcctgcggacc
gtcggtacgagggagcggcgttcgcacctcacggcacccagagtgcccaccgtcggcatc
gacatcggcggtaccaaggtgatggccggcgtcgtcgacgccgacggcaacatcctggag
accctgcggaccgagacaccggacaagtccaagagccccaaggtcgtcgaggacaccatc
gtcgagctcgtcctggacctctccgaccggcacgacgtccacgccgtcggcatcggcgcg
gcgggctgggtggacgccgaccgttccaaggtgctcttcgccccgcacctggcctggcgc
gacgaacccctcagggacgcgctcgcctcccgcctcgtcgtccccgtcatggtggacaac
gacgccaacacggccgcctgggcggagtggcgcttcggcgccggccgcggcgaggaccac
ctggtcatgatcacgctgggcaccggtatcggcggcgcgatcctggaggacgggcacgtc
aagcggggcaagtacggcgtcgccggtgagttcggccatatgcaggtcgtgcccggtggg
caccgctgcccgtgcgggaaccgcggctgctgggagcagtacagctccgggaacgccctg
gtgcgcgaggcgaaggagctggccgccgccgactctccggtcgcccacggcatcatcgag
cgggtcaaggggaacatccccgacatcaccggcccgctcatcaccgagctggcccgcgag
ggcgacgcgatgtgcgtcgaactcctccaggacatcggccagtggctcggggtcggcatc
gccaacctcgcggccgcgctcgacccctcgtgcttcgtcatcggcggcggcgtcagcgcg
gccgacgacctgctgatcgggccggcccgggacgccttcaagcgccagctcaccggacgc
ggctaccgccccgaggcccggatcgccaaggcccagctcggtcccgaggccggtatggtc
ggcgccgccgacctggcacgcctggtcgcgcggcggttccggcggaccaaccgccgccgg
gtcgagcggtacgagcgctacgcccagatctacgaccaggccgcgagcacgctccgcagc
acgcgcaacggcacccgggacgccggctga

DBGET integrated database retrieval system