KEGG   Streptomyces sp. SirexAA-E: SACTE_5703Help
Entry
SACTE_5703        CDS       T01601                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssx01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ssx00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6480046..6480942
Genome map
AA seq 298 aa AA seqDB search
MRNIVVIDAPSNLGLRPPAPGTVPGCCKLAGALRERRIVQRLGATEGGVVVPPRYDLGDW
REGDGVFNAAAIARYTRTLADRVETHVRANDFPLVLGGDCSIQLGCTLALRRIGRYGLAA
VDGSADFRHPGNSDRIGAAGGEELALATGRGQTDLTDLEGLGPYLRDEDVRLFGMRDGDE
DRAEMAALKIPNATVGEIRERGPADLAREVVQSLEVPGLDGFWVHFDADVLDPSVMPAVD
SPDDGGLFPEELAPILRTLLRSPRCVGLNVTIYDPDLDPDGTAGTLLADLVVAALRED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatatcgtggtcatcgacgccccgtccaacctgggcctgcggccccccgccccc
ggaaccgtccccggctgctgcaaactcgccggggcgctgcgcgagaggcggatcgttcag
cggctcggcgccaccgaaggcggcgtcgtcgtgcctccgcgctacgacctaggggactgg
cgggagggcgacggcgtgttcaacgccgcggcgatcgcccgctacacccgtacgctcgcc
gaccgcgtcgaaacccatgtcagggccaacgacttcccgctcgtcctcggcggggactgc
tcgatccagctcggctgcaccctcgccctgcggcgcatcgggcggtacgggctcgcggcg
gtcgacggttccgccgacttccgccacccgggcaacagcgaccggatcggagccgcgggc
ggcgaggaactggcgctggccaccggccgcggccagaccgacctcaccgacctggaaggg
ctcggcccctatctgagggacgaggacgtccggctcttcgggatgcgcgacggcgacgag
gaccgcgccgagatggccgccctgaagatccccaacgccacggtcggggagatccgcgag
cggggcccggccgacctcgcccgggaggtggtgcagagcctggaggtgccgggcctcgac
gggttctgggtgcacttcgacgccgacgtcctcgatccgagcgtcatgccggccgtggac
agccccgacgacggcggcctgttccccgaggagctcgcaccgatcctgcgcaccctgctg
cgctcgccccgctgcgtcgggctcaacgtcaccatctacgaccccgacctggaccccgac
ggcaccgccggcaccctgctcgccgacctcgtggtggcggcccttcgtgaggactga

DBGET integrated database retrieval system