KEGG   Streptomyces sp. SirexAA-E: SACTE_5762Help
Entry
SACTE_5762        CDS       T01601                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SACTE_5762
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SACTE_5762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6553403..6554350
Genome map
AA seq 315 aa AA seqDB search
MHDNEDPAPSRFSRYDLLVVGSANADLVVGVERRPAPGETVLGSDLVVHPGGKGANQAVA
AARLGARTALLARVGDDAHGRLLRESQRAAGVDTGPVLVGGAPTGVALITVDPSGDNSIV
VSPGANARLTPGDIRAAGPLFAAARVVSVQLEIPLETVAETARALAPGTRLVLNPSPPAP
LPADVLAACDPLVVNEHEARYILGILGQEAGSAPEEWADTLLAHGPRSVVVTLGAEGALI
ADSRGGGPVHVPSPKVDAVDTTGAGDAFTAALAWRLGLGDELAEAAAFAVRVGAAAVTRQ
GAQASFPTAQEVAAL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaacgaggaccccgcgccctcccggttctcccggtacgacctcctggtcgtc
ggctcggccaacgccgacctggtcgtcggcgtcgagcgccggcccgcgccgggggagacg
gtgctcggctccgacctcgtcgtccaccccggcggcaagggcgccaaccaggccgtcgcc
gccgcccgcctcggcgcccgtacggcgctgctggcccgggtcggcgacgacgcccacggg
cggctgctgcgcgagtcgcagcgggcggcgggcgtcgacaccggcccggtcctcgtcggc
ggggcgcccaccggggtcgccctcatcaccgtcgacccctcgggcgacaacagcatcgtg
gtctccccgggcgccaacgcccggctgacccccggagacatccgggcggcgggccccctg
ttcgccgccgcccgggtcgtctccgtacagctggagatccccctggagaccgtcgccgag
acggcccgtgcgctcgccccggggacccggctggtcctcaacccgtccccgcccgcacca
ctgcccgccgacgtcctggcggcctgcgacccgctggtggtcaacgagcacgaggcccgc
tacatcctgggcatcctgggacaggaggcgggaagcgccccggaggagtgggcggacacc
ctgctcgcccacggcccgcgctcggtggtggtcaccctgggtgcggagggcgccctgatc
gccgacagccgcggcggcggccccgtgcacgtaccgagtccgaaggtcgacgcggtggac
accacgggcgcgggcgacgccttcaccgccgccctcgcctggcgtctggggctcggcgac
gagctggcggaggccgccgcgttcgccgtgcgggtaggagcggcggcggtcacccggcag
ggcgcgcaggcgtccttccccaccgcccaggaggtggccgcgctgtga

DBGET integrated database retrieval system