KEGG   Streptomyces sp. SirexAA-E: SACTE_5800Help
Entry
SACTE_5800        CDS       T01601                                 

Definition
Pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SACTE_5800
   00500 Starch and sucrose metabolism
    SACTE_5800
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SACTE_5800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6597411..6598499
Genome map
AA seq 362 aa AA seqDB search
MAVTRRRRTPHGPARNRALVAGATAFLAVASLQAFGPAPDAAAATTLTVAKDGTGQYTTV
QAAVNAIPAGNTARVVVSIRPGTYRETVKIPSNKQNVTLQGSGSSRKDTVIVHANASGTP
KPDGSGTYGTSGSATVAAEADGFQARNLTISNDFDEAAHQDMADRQAVALRTAADKVFLD
SVIVTGDQDTLLLDTASKAALGRVYMVNSYVVGNVDFIFGRASAVIDRSVITLKKRWDGS
SAGYVTAPSTAAGRKGFLITASTVNGDVAAAAFHLGRPWHAGGDASLDPMATFRDTTLGA
GVKSAPWTDMSGFSWKDDRFAEYRNTGPGSGPASSERPQLTDSQAAAQETADWLAGWTPT
AS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacccgacgacgacgcaccccgcacggccccgcccggaaccgggccctggtg
gcgggcgcgaccgccttcctggccgtcgcctccctccaggcgttcggaccggcacccgac
gcggcggcggcgaccaccctgacggtcgccaaggacggcaccgggcagtacaccaccgtg
caggcggcggtgaacgcgatccccgcgggcaacaccgcgcgcgtcgtcgtctccatcagg
cccggcacctaccgggagacggtgaagatcccgtcgaacaagcagaacgtcaccctccag
ggcagcggctccagccgcaaggacaccgtcatcgtccacgccaacgcctccggcacgccc
aagcccgacggctccggcacctacggcacgagcggcagcgccaccgtcgcggccgaggcc
gacggcttccaggcccgcaacctcaccatctccaacgacttcgacgaggccgcgcaccag
gacatggccgaccgccaggcggtcgccctgcgcaccgccgcggacaaggtgttcctcgac
tccgtcatcgtcaccggcgaccaggacacgctgctgctcgacaccgcgtccaaggcggcg
ctcggccgcgtctacatggtgaactcctatgtcgtcggcaacgtcgacttcatcttcggg
agggccagcgcggtcatcgaccggtcggtcatcaccctgaagaagcgctgggacggcagc
tcggccgggtacgtcaccgcgcccagcacggccgccggccgcaagggcttcctgatcacc
gcctcgaccgtgaacggagacgtcgcggcggccgccttccacctcggccggccctggcac
gccggcggggacgcgtccctggaccccatggccaccttccgggacaccacgctcggcgcg
ggcgtcaagtccgccccgtggaccgacatgagcggcttctcgtggaaggacgaccgcttc
gccgagtacaggaacaccggacccggctcgggcccggcgagcagcgagcggccgcagctc
accgactcccaggccgcggcacaggagaccgcggactggctggccggctggacaccgacg
gcgtcctga

DBGET integrated database retrieval system