KEGG   Streptomyces sp. SirexAA-E: SACTE_5828Help
Entry
SACTE_5828        CDS       T01601                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SACTE_5828
   00051 Fructose and mannose metabolism
    SACTE_5828
Enzymes [BR:ssx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SACTE_5828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6641027..6642196
Genome map
AA seq 389 aa AA seqDB search
MPERFTPTPEDKFTFGLWTVGWRGNDPFGEPTRPVLDPVESVERLAELGAHGVTFHDDDL
IPFGSDDRERARLVGRFREALERTGLKVPMATTNLFTHPVFKDGGFTSNDRDVRRFALRK
VIRNIDLAVELGAQTYVAWGGREGAESGAAKDVRSALDRMKEAFDLLGDYVTEQGYDLRF
AIEPKPNEPRGDILLPTIGHALAFIERLERPELVGVNPETGHEQMAGLNFPHGIAQALWA
GKLFHIDLNGQSGIKYDQDFRFGAGDLRQAFWLVDLLETAGWDGSRHFDFKPVRTDGIDG
VWESAKNCMRNYLILKERAAAFRADPAVQEALTASRLDELARPTADDGLKALLADRTAYE
DFDATAAAERSMAFEALDQLAMDHLLNVR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcgtttcactcccactcctgaggacaagttcacgttcggtctgtggaccgtg
ggctggcggggcaacgacccgttcggtgagccgacgcgtccggtgctggacccggtggag
tcggtcgagcggctggcggagctcggtgcgcacggggtgacgttccatgacgacgacctg
attccgttcgggtcggacgaccgtgagcgggcgcggctggtcgggcggttcagggaggcg
ctggagcgtaccgggctcaaggtgccgatggcgacgacgaacctgttcacgcacccggtg
ttcaaggacggcgggttcacctccaacgaccgtgacgtgcggcggttcgcgctgcgcaag
gtgatccgcaacatcgatctcgcggtggagctcggcgcgcagacgtatgtggcctggggc
gggcgtgagggcgccgagtccggtgcggccaaggacgtgcggtcggccctggaccggatg
aaggaggccttcgacctgctgggcgactacgtcaccgagcagggctacgacctgcggttc
gcgatcgagcccaagcccaacgagccccgcggtgacatcctgctgcccacgatcgggcac
gcgctggccttcatcgagcgcctggagcgccccgagctggtcggggtgaacccggagacc
gggcacgagcagatggccgggctgaacttcccccacggcatcgcgcaggccctgtgggcg
ggcaagctcttccacatcgacctcaacggccagtccgggatcaagtacgaccaggacttc
cgcttcggcgccggtgacctgcgccaggcgttctggctcgtggacctcctggagacggcc
ggctgggacggctcacgccacttcgacttcaagccggtacgcaccgacggcatcgacggg
gtgtgggagtccgcgaagaactgcatgcgcaactacctcatcctcaaggagcgcgccgcc
gccttccgcgccgaccccgccgtccaggaggccctcaccgcctcccgcctcgacgaactc
gcccgccccaccgccgacgacggcctcaaggcactcctcgccgaccgcaccgcctacgag
gacttcgacgccaccgccgccgccgaacgctccatggccttcgaagccctcgaccagctc
gccatggaccacctcctcaacgtccgctga

DBGET integrated database retrieval system