KEGG   Streptomyces sp. SirexAA-E: SACTE_5896Help
Entry
SACTE_5896        CDS       T01601                                 

Definition
NAD-binding protein 3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACTE_5896
   01212 Fatty acid metabolism
    SACTE_5896
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACTE_5896
   00650 Butanoate metabolism
    SACTE_5896
  Lipid metabolism
   00071 Fatty acid degradation
    SACTE_5896
   01040 Biosynthesis of unsaturated fatty acids
    SACTE_5896
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_5896
   00310 Lysine degradation
    SACTE_5896
   00380 Tryptophan metabolism
    SACTE_5896
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACTE_5896
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACTE_5896
   00281 Geraniol degradation
    SACTE_5896
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SACTE_5896
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SACTE_5896
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACTE_5896
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SACTE_5896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6710130..6712301
Genome map
AA seq 723 aa AA seqDB search
MTESTTIRWEQDETGIVTLVLDDPGQSANTMNQAFKDSIAAVADRAEAEKDSIRGIIYTS
AKKTFFAGGDLKDMIKVGPEDAQAAFDTGTAIKNSLRRIETLGKPVVAAINGAALGGGYE
IALASHHRVALDAPGSRIGLPEVTLGLLPAGGGVTRTVRLMGITDALLKVLLQGTQYTPA
RALENGLVHEIAATREEMLAKARAFIDTHPESRQPWDVKGYRIPGGTPSHPKFAANLPAF
PANLRKQLAGAPMPAPRNIMAAAVEGSQVDFETALTIEARYFTELVTGQVAKNMIQAFFF
DLQAVNSGASRPGGVEERQVRKVAVLGAGMMGAGIAYSCARAGLDVVLKDVSTEAAEKGK
AYSEKLLAKALSRGRTTEAKRDELLARITPTGDPADLAGCDAVIEAVFEDTALKHKVFQE
IQDVVEPDALLCSNTSTLPITVLAEGVERPADFIGLHFFSPVDKMPLVEIIKGDKTGDEA
LARAFDLVRRIKKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRDETRRAIEEAGGTWPAHPADAVVDRMVDEFGRPGRSGGAGF
YEYGEDGRRGLLWPGLREHFTRPGAEIPFEDMQERMLFSEALDSVRCLEENVLTTVADAN
IGSIMGIGFPPWTGGVLQYINGYEGGLPGFVARARQLAERYGDRFLPSPLLLEKAEKGET
FHD
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcacgaccatccgctgggaacaggacgagaccggcatcgtcaccctcgtc
ctggacgatcccggccagtccgccaacacgatgaaccaggcgttcaaggactcgatcgcc
gccgtcgccgaccgggccgaggccgagaaggactccatccggggcatcatctacacctcc
gccaagaagaccttcttcgcgggcggcgacctcaaggacatgatcaaggtcggccccgag
gacgcccaggccgccttcgacaccggtaccgcgatcaagaactcgctgcgccgcatcgag
acgctcggcaagccggtcgtcgccgcgatcaacggtgccgcgctcggcggcggttacgag
atcgccctcgcctcccaccaccgcgtcgccctggacgccccgggctcccgcatcggcctg
cccgaggtcaccctcggcctgctgcccgcgggcggcggcgtcacccgcaccgtacgcctc
atgggcatcaccgacgcgctgctcaaggtcctcctccagggcacccagtacacccccgcc
cgggcgctggagaacggcctggtccacgagatcgccgccacgcgcgaggagatgctcgcc
aaggcgcgcgccttcatcgacacccacccggaatcgcggcagccctgggacgtcaagggc
taccgcatccccggcggcaccccgtcccatccgaagttcgccgccaacctgcccgccttc
cccgccaacctgaggaagcagcttgcgggcgcgcccatgcccgcgccccgcaacatcatg
gccgcggcggtcgagggatcgcaggtcgacttcgagaccgctctgaccatcgaggcccgc
tacttcaccgaactggtcaccggccaggtcgcgaagaacatgatccaggccttcttcttc
gacctccaggccgtcaactccggggccagccgcccggggggagtggaggaacgccaggtc
cgcaaggtcgccgtcctcggcgccgggatgatgggtgcgggcatcgcctactcctgcgcc
cgcgccggcctcgacgtcgtcctcaaggacgtctccaccgaggcggccgagaagggcaag
gcctacagcgagaagctgctcgccaaggcgctctcccggggccgtacgaccgaggcgaag
cgcgacgaactgctcgcccgcatcacccctaccggcgacccggcggatctggccggctgc
gacgcggtgatcgaggccgtcttcgaggacaccgcgctcaagcacaaggtgttccaggag
atccaggacgtcgtcgagcccgacgcgctgctctgctccaacacctccaccctgcccatc
acggtcctcgccgagggcgtggagcggcccgccgacttcatcgggctgcacttcttctcg
ccggtcgacaagatgccgctggtggagatcatcaagggcgacaagaccggtgacgaggcg
ctggcccgcgccttcgacctggtgcgccggatcaagaagaccccgatcgtcgtcaacgac
tcccgcggcttcttcacctcgcgtgtcatcggccacttcatcaacgagggcgtcgccatg
gtcggcgagggcatcgagcccgcgtccgtcgagcaggcggcggcgcaggccggctacccg
gccaaggtcctcagcctgatggacgagctgaccctcaccctcccgcgcaagatccgcgac
gagacccggcgcgcgatcgaggaggcgggcggcacctggcccgcacaccccgccgacgcg
gtcgtcgaccggatggtcgacgagttcgggcggcccggacgcagtgggggagcgggcttc
tacgagtacggcgaggacggccggcggggcctgctgtggccggggctgcgcgagcacttc
acccggcccggcgccgagatcccgttcgaggacatgcaggagcggatgctcttctccgag
gcgctggacagcgtccgctgtctggaggagaacgtcctgacgaccgtcgccgacgccaac
atcggctcgatcatggggatcggcttcccgccctggaccggcggcgtactccagtacatc
aacggctacgagggcggcctgcccggcttcgtggcccgcgcccggcagctcgccgagcgc
tacggcgaccgcttcctgccgtcgccgctgctgctggagaaggcggagaagggcgagacc
ttccacgactga

DBGET integrated database retrieval system