KEGG   Streptomyces sp. SirexAA-E: SACTE_6011Help
Entry
SACTE_6011        CDS       T01601                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssx00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ssx00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ssx00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6833789..6835900
Genome map
AA seq 703 aa AA seqDB search
MTPARRAAVAVGAAALLAVPVPAAHAGQRPDQGAPPSHGSNPAATPYMGWNTYYGLGAPT
ETEVREIADFLVGSGLKSSGYDIVWLDGGWQADDPRDGRGRLVAHPDRFPSGIPALVDYL
HERGLRAGIYTDAGTYDGGETCGLGSRGHYQEDARQFAGWKVDAIKVDFLCGITEKLDPG
PAFKEFGDAVAKSGRRMLLNLCNPLTDDWGIPHTPAQDAHNAYVYGPTTADSWRTGTDIA
WGTPSAGQWPNVLRNMDANAWHPEAQGPGHYNDPDYLIPMRTLQDGSYELTAEESTTQLV
MWAEMGSPLVIGSDPRTLPRQMIDTLRNPEIIAVDQDPLAIQGVRVATDATGDVYSKVLQ
GSGRRAVVLLNRSDRPAERTVDFADAGLAGKVGVRDLRARKDRGKHTGSYTVEVPAHGTA
FLTLTGRDDAPGASLGVRSDASPALVRDGDRVSVFTRGADGSLRQRTGHEGRGDARTTGL
GGPTHGRIVGAPVAHTDGHGRIDVFVRGTDDAAYRLSYAGGRWGRWQKLGGRLADSPAVA
YENPGSWTLFARGADGRIQVRGPRTGWTSFDGPEDASLYGRPSVATDGAGRTHLAVRADD
DSVRTRVQDPSGAWSDWSSLGGTVSGSPTLVADGQQVRLYARAGDYTLWGRTYATGTGWG
DWSQEKRFASGAFDGELAAVAGPDGAVLTAFRGVAGVVRQGRL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgcccggcgcgccgcggtcgctgtgggggcggccgcactgctcgccgtcccg
gtgcctgccgcacacgccggccagcggcccgaccagggcgcgccgccgtcccacggcagc
aacccggcggccacgccgtacatgggctggaacacctactacggcctcggcgccccgacg
gagaccgaggtcagggagatcgccgacttcctggtcggcagcggcctgaagagcagcggt
tacgacatcgtctggctcgacggcggctggcaggccgacgatccgcgggacggccggggg
cggctcgtcgcgcacccggaccgcttcccctccggcatccccgccctggtggactacctc
cacgagcgcgggctgcgcgccggtatctacaccgacgccgggacctacgacggcggcgag
acctgtggcctcggcagccgtggccactatcaggaggacgcgcggcagttcgccggctgg
aaggtcgacgcgatcaaggtcgacttcctctgcgggatcaccgagaagctcgatccggga
cccgcgttcaaggagttcggcgacgccgtcgccaagtccggccggcgcatgctgctcaac
ctgtgcaacccgctgaccgacgactgggggatcccgcacacaccggcgcaggacgcccac
aacgcctacgtgtacgggccgacgaccgccgactcctggcggacgggcaccgacatcgcg
tggggcaccccgtccgccggccagtggccgaacgtgctgcgcaacatggacgccaacgcc
tggcaccccgaggcacaggggccgggtcactacaacgaccccgactacctgatcccgatg
cgtacgctccaggacggctcgtacgagttgaccgccgaggagtcgaccacccagctggtg
atgtgggccgagatgggctccccgctggtcatcggctcggacccgcgcaccctgccccgg
cagatgatcgacaccctgcgcaacccggagatcatcgccgtcgaccaggaccccctcgcg
atccagggagtgcgcgtcgccacggacgcgaccggtgacgtctacagcaaggtgctccag
ggttccggccgccgggcggtggtgctgctcaaccgctccgaccggcccgccgagcgcacg
gtggacttcgccgacgccggactggcggggaaggtcggggtgcgggacctgcgggccagg
aaggaccgcgggaagcacaccggctcgtacaccgtcgaagtccccgcccacggcaccgcg
ttcctcacgctgaccggccgggacgacgccccgggcgcctcgctcggggtgcgctcggac
gcgagcccggccctggtgcgggacggtgacagggtcagcgtgttcacccgtggcgcggac
ggttcgctgcggcagcggaccgggcacgaggggcggggggacgcgcggaccaccggtctc
ggcggtcccacgcacgggcggatcgtgggagcgcccgtcgcccacacggacgggcacgga
cgcatcgacgtcttcgtccggggcaccgacgacgccgcctaccggctctcctacgccggc
ggccggtggggccggtggcagaagctcggcggacggctcgcggacagccccgccgtcgcc
tacgagaacccggggagctggaccctcttcgcccggggagcggacggacgcatccaggtg
cgcgggccgcggaccggctggacctcgttcgacgggccggaggacgcgtcgttgtacgga
cggccgtcggtggccaccgacggggcggggcgcacccacctcgccgtccgcgccgacgac
gactcggtccgtacccgggtgcaggacccctccggcgcctggtcggactggtcgtcgctg
ggcgggacggtgagcggcagccccaccctcgtcgccgacgggcagcaggtgcggctgtac
gcacgtgccggtgactacacgctctgggggcggacctacgccaccggcaccggctggggc
gactggtcgcaggagaagcgcttcgccagcggggccttcgacggcgaactcgccgccgtg
gccgggcccgacggcgccgtgctcacagccttccgcggtgtggccggagtcgtccgccag
ggccggctctga

DBGET integrated database retrieval system