KEGG   Streptomyces sp. SirexAA-E: SACTE_6015Help
Entry
SACTE_6015        CDS       T01601                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACTE_6015
  Lipid metabolism
   00561 Glycerolipid metabolism
    SACTE_6015
   00600 Sphingolipid metabolism
    SACTE_6015
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SACTE_6015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6839191..6841293
Genome map
AA seq 700 aa AA seqDB search
MSSYDRWLLRTENTTYAVRIAGEGRWAELASWGPHGTETGPSPFAVPHRTHFVTPADAAP
AEYLPHGLRPFSGADLVVRRPGRERGTWWTFDSATQDGDRALRLTFADEEQGLRAALCYE
TVPGTDVILRWTELSCTGEEELRLERLDSAAVSIPVTDGARLTYLTGQWSQEFRRTQLEL
TRGRFEMASTQGVPGHAYAPWLAVQDAAEPAEGATPTYGVALEWSGNWHMAADAEPGGAV
RIRAGRVPHEGAVRLAPGATLTTPRLACAFSPDGLDGLARVWHRYERRLSGERLDRTRKV
LYNSWEATGFDVDAAAQLELARIAADMGAELFVVDDGWFTGRHDETGGLGDWFPDPANFP
DGFDHFIDEVRATGMDFGLWVEPEAVSPASRLYAEHPEWVYRIDGRPATLVREQLLLDLG
RRDVQDFVVATLDRLLGDHAISYLKWDMNRPPTERGRPGGGPVEEQDLDAAHVAGYLRVL
DHLRARHPHVTVEGCAGGGGRIEHATLARTDVVWPSDNTAPLDRLAIQYGYLHAHAPHTM
SSWVTDSPGVFDPRPRSLAFRFVTAMAGVLGIGADIRHWSAGQRAEAARWVSRYKEIRDV
VHRGEVRLLGSPADATCGVQYDEQDGARTVVTAWNTGRLDGAPLVPGRAARLRLRGLDPA
ARYADERTGTVHGGAHLLHYGLPFAWTAQYDAELVVLVRQ
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcgtacgaccggtggctgctgcgcaccgagaacaccacctacgcggtacggatc
gcgggcgagggccggtgggccgaactcgcctcctggggcccgcacggcaccgagacgggc
ccgtcccccttcgccgtgccgcaccgcacacatttcgtcaccccggccgacgcggccccc
gccgagtacctcccccacgggctgcgccccttctccggcgccgacctggtcgtccggcgt
cccggccgggaacgcggcacctggtggaccttcgactccgccacccaggacggcgaccgg
gccctgcgcctcaccttcgccgacgaggaacagggactgcgcgcggcgctctgctacgag
accgtgcccggcaccgacgtcatcctgcgctggaccgaactgagctgtaccggcgaggag
gaactgcgcctggaacgactcgactccgccgccgtcagcatccccgtcacggacggcgcc
cggctcacctacctcaccggccagtggtcccaggagttccggcgcacccagctcgaactg
acccgcggccgcttcgagatggcctccacccagggcgtccccggccacgcctacgcgccc
tggctggccgtgcaggacgccgccgagccggccgagggcgccaccccgacgtacggcgtc
gccctggagtggtccgggaactggcacatggccgccgacgccgaacccgggggcgcggta
cggatcagggccggccgggtgccgcacgagggcgccgtccggctcgcccccggcgccacc
ctcaccacaccacgcctggcctgcgcgttcagcccggacggcctcgacgggctggccagg
gtctggcaccgctacgaacgccggctcagcggcgagcgactcgacaggacccgcaaggtc
ctctacaactcctgggaggcgaccggcttcgacgtcgacgccgccgcccagctcgaactc
gcccgcatcgccgctgacatgggcgcggagctcttcgtcgtcgacgacggctggttcacc
gggcggcacgacgagaccggcggactgggcgactggttccctgacccggcgaacttcccc
gacggcttcgaccacttcatcgacgaggtgcgcgccaccggcatggacttcggcctctgg
gtcgaacccgaagccgtcagcccggcctcccggctctacgccgaacacccggaatgggtc
taccggatcgacggccgccccgccacgctggtgcgcgagcagctcctgctcgacctcggc
cgcagggacgtccaggacttcgtcgtcgccaccctcgaccggctcctgggcgaccacgcg
atcagctacctcaagtgggacatgaaccgtccgcccaccgaacgaggccggcccggcggc
ggccccgtggaggaacaggacctggacgccgcacacgtcgccggatacctccgggtgctc
gaccatctgcgcgcccgccacccccacgtcaccgtcgagggctgcgccgggggcggcggc
cggatcgaacacgccaccctcgcccgtaccgacgtggtgtggcccagcgacaacaccgcc
ccgctggaccgcctcgccatccagtacggctatctgcacgcgcacgccccgcacaccatg
agctcctgggtcaccgactcgcccggcgtcttcgacccgcggccccggtccctcgccttc
cgtttcgtcacggccatggccggagtcctcggcatcggcgccgacatccgccactggtcc
gccggacagcgcgccgaggcggcccggtgggtgagccgctacaaggagatccgcgacgtc
gtccaccgcggcgaggtccggctgctgggcagcccggccgacgccacctgcggcgtccag
tacgacgagcaggacggtgcccggaccgtcgtcaccgcctggaacaccggacgcctggac
ggggcgccgctcgtccccgggcgcgccgcccggctgcggctgcgcggtctggacccggcc
gcccgctacgccgacgagcggaccgggaccgtccacggcggcgcccatctgctccactac
ggcctgcccttcgcctggaccgcgcagtacgacgcggaactggtcgtcctggtcagacag
tag

DBGET integrated database retrieval system