KEGG   Streptomyces sp. SirexAA-E: SACTE_6282Help
Entry
SACTE_6282        CDS       T01601                                 

Definition
phosphoesterase PA-phosphatase-like protein
Organism
ssx  Streptomyces sp. SirexAA-E
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7128691..7131579)
Genome map
AA seq 962 aa AA seqDB search
MVVAVLLAGSLGAGSATADTGHRAGAPPEVGGFWATSYEPGTPRPAGFPAQGHPRNLRGE
TARVTTTVSGVRSDHPNDTSATEGVRSLADQDPGTKWYARDSGRPTAAGPVHAIYSLRTP
AAVTGYSLTSANDAPPRDPAAWTVLGSDSDLAAKDADHSSWKVLDQEKGQRFGARGQSNF
YPLGTVHAYRHYQLRITDNCSDRCEGPAADREKLQLADWTLRSSAGSSASALGVEVESAD
AVGAADGSAALRYAGRVLASGPASSTVVLRSGLDVPLVPTSRLSYAIRPDDAASAHVALD
VVLTDRDGRHPRTHRAGSGGTTVVPGEWTTVSADLGALAGQRVSEIRLRYEDPHATSGAK
PTGWIDDLRIGKAVVDESTTWSYLDTPDVDPARGGGDRTAWTRTGFDPGDVPWKEAAGPF
GAKNDGTDLGADFPVRTGLTLRKDAGDSLEAYFFRTSFSMDRTSLDAITGLLGTVVYDDT
VTVYLNGRRVAGHGDGQIEKNLQYETPDGTSGEGDPVTAHFGVPVTALREGTNTLAVEVH
QCNGTSSDAYFGLRSLAQTADSLPFTDEQLGTSYPSDTQPTAPGGEDYFTWLLRSFDTAR
DTPAVMGANETLPKGTTYEELTALNDRTVVDINNAPSGPTDPQVHKALVDGAGRPYRTMA
DGLGGTLGRLYEQALKNGELPKTEALLSGRVEHTPDSSADWYQTAKNNYRYKRPFVRMGF
RNDQGLIEQWDSPGGYAGLAGDGSFPSGHTSHGYAQGIVLATLLPELAPQILARASEYGN
NRILLAFHYPTDIMGGRVVGEKTAQLRWSDPGFRTLLEQSKEELETVLAQKCREVGAGGP
PARCAAAGKPYLPTADALGTYKQRLTYGYPRVGAEGLPPAVPDGAEDLLRTAHPKLSDNQ
RRTVLAATQLPSGSVLDEQGDGGSWQRIDLAAAMAAEVTAHRDGTLTVDGVRVNAEGVRV
GR
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtggccgtgctcctggcgggctcactcggagccgggtcggccacggccgacacc
ggccaccgagccggcgcgccaccggaggtgggcgggttctgggccacgtcctacgagccc
gggacgccccggcccgccggattcccggcccagggacacccccggaatctgcgcggcgag
accgcccgtgtcaccaccaccgtgagcggcgtacgctccgatcaccccaacgacacgagc
gcgacggaaggcgtcaggagcctcgccgatcaggaccccggcaccaagtggtacgcgcgt
gacagcggacggcccaccgcggccggacccgtccacgcgatctactccctccgcactccg
gcggccgtcacgggctactcgctcacctccgcgaacgacgcgccaccacgcgatcccgcc
gcctggaccgtgctcggcagcgacagcgacctcgccgcgaaggacgcggaccactcctcg
tggaaggtcctggaccaggagaagggacagcgcttcggcgcccgcgggcagagcaacttc
tacccgctcggcaccgtgcacgcgtaccgccactaccagctccgcatcaccgacaactgc
tccgaccggtgcgagggtccggccgccgaccgcgagaagctccagctcgccgactggacc
ctgcgcagctccgcggggtcatctgcctcggcactgggggtagaggtcgagagcgccgat
gcggtgggcgcggccgacggctccgccgcgttgcggtacgcgggccgcgtcctcgcgtcc
ggaccggcctcctccacggtggtcctgcgctccgggctcgacgtcccgctcgtgcccacc
tcccgtctgagctatgcgatccgcccggacgacgccgcctccgcccacgtcgcgctcgac
gtcgtcctcaccgaccgggacggccggcacccgcgcacccaccgggcggggtccggtggc
acgacggtcgtcccgggtgagtggaccaccgtgtcggccgacctcggtgccctcgccggt
cagcgcgtcagtgagatccggctgcgctacgaggacccgcacgccacgtcgggagcgaag
cccaccggctggatcgacgacctccgcatcggcaaggcggtcgtcgacgaatcgaccacc
tggagctacctcgacaccccggatgtcgacccggcacgcggaggcggggaccgcacggcg
tggacccgcaccggcttcgacccgggagacgtcccctggaaggaggcggccggccccttc
ggtgcgaagaacgacggcaccgacctcggcgccgacttccccgtccgtaccggactgacg
ctccgtaaggacgcgggcgacagcctcgaggcgtacttcttccggacctccttctcgatg
gaccgcacctccctcgacgcgatcaccgggctgctcggcacggtcgtctacgacgacacc
gtgaccgtctatctcaacggccgccgcgtcgccggccacggggacggccagatcgagaag
aacctccagtacgagaccccggacggcacgtccggcgagggcgacccggtcaccgcccac
ttcggcgtcccggtcaccgccctgcgcgaggggaccaacacgctggccgtcgaggtccac
cagtgcaacggcacgagctcagacgcctacttcgggctccgctcactcgcacagaccgcc
gactccctgcccttcaccgacgaacagctcggcacgtcctacccctccgacacacagccc
accgcgccgggcggcgaagactacttcacctggctgctgcgctcgttcgacaccgcccgg
gacacccccgcggtcatgggggccaacgagacgctgccgaagggcacgacgtacgaggag
ctgaccgcgctcaacgaccggacggtcgtcgacatcaacaacgccccttccgggcccacc
gatccccaggtgcacaaggcgctcgtggacggtgcgggccggccgtaccggacgatggcg
gacggactgggcggcactctcggccgcctctacgaacaggcgctgaagaacggcgaactg
cccaagaccgaagccctgttgtccggccgcgtcgaacacaccccggactcctccgccgac
tggtaccagaccgccaagaacaactaccgttacaagcgccccttcgtccgcatgggcttc
cgcaacgaccagggcctcatcgagcagtgggacagtcccggcggctacgccggtctcgcg
ggcgacggctccttcccgagcggacacaccagccacggctatgcgcagggcatcgtcctc
gccaccctgctgcccgaactggcgccgcagatcctcgcgcgcgcctcggagtacggcaac
aaccgcatcctgctggccttccactatccgaccgacatcatgggcggccgcgtcgtcggc
gagaagaccgctcaactgcggtggtccgacccggggttccggacgctcctggagcagtcg
aaggaggagctggagacggtcctcgcgcagaagtgccgggaggtcggggcgggcggtcca
ccggcgcgctgcgccgccgccgggaagccgtacctgcccacggccgacgcgctcggtacg
tacaagcagcggttgacctacggctacccgcgcgtcggcgcggagggcctgccaccggcc
gttccggacggggcggaggacctgctgcgcacggcccacccgaagctcagcgacaaccag
cgccgcacggtcctcgccgccacccagcttccttccggctccgtgctggacgagcagggc
gacgggggaagctggcagcggatcgacctcgcggcggcgatggccgccgaggtcacggcg
caccgtgacggcacgctcaccgtcgacggagtacgggtgaatgccgagggagtacgcgtc
ggacggtag

DBGET integrated database retrieval system